SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002528 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002528
Domain Number 1 Region: 19-261
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.41e-75
Family Eukaryotic proteases 0.00000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002528   Gene: ENSTGUG00000002454   Transcript: ENSTGUT00000002552
Sequence length 262
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:47203608:47208197:1 gene:ENSTGUG00000002454 transcript:ENSTGUT00000002552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HQTGIMSAFLPWYTFTAVILLVIHGGLCVDIIGGYEVEPHSRPFMAQIKGSEGIICGGAL
IKENWVLTAAHCKVKKSKVILGAHSSKKREEEQQVFQIAKDIPYPCYDPSTKEHDIMLLQ
LQGRAKLNKAVQPIPLPPSDDDPKPGTVCAVAGWGLTGNHRGKFPTALMEVNITVIRREL
CNDKNHYNGKPVITENMICAGAKNGGKDSCNGDSGGPLRCNNIMRGITSFGKLKKCGFAG
SPGVYARLTKRHLEWIRKTIGG
Download sequence
Identical sequences H0YW55
ENSTGUP00000002528 59729.ENSTGUP00000002528 ENSTGUP00000002528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]