SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002531 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002531
Domain Number 1 Region: 243-394
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.01e-23
Family MAM domain 0.013
Further Details:      
 
Domain Number 2 Region: 36-193
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.65e-22
Family MAM domain 0.016
Further Details:      
 
Domain Number 3 Region: 423-464
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 201-237
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002531
Domain Number - Region: 6-25
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0393
Family LDL receptor-like module 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002531   Gene: ENSTGUG00000002460   Transcript: ENSTGUT00000002555
Sequence length 480
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:310465:314898:-1 gene:ENSTGUG00000002460 transcript:ENSTGUT00000002555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGSMAEQLCNFVCDCSDCSDENQCGYLRGSAVLGTPFTCDFEDSDCGWQDVGTSMYGWVR
GRASLATWGMGPHSDHTVGTDLGKSMEGGSSAAKIAATAWLRSPEMREAAATCEIRTWYH
LSGSWRPVLRLAVAHKDEVVELWQSPERSSEGWHQLVAYPGRIMDQFQLIFSLTQPPTCG
AEVALDDIMFRNCGLPEVGQQACGAQASRCHRGSCLEQQRFCDGTDDCGDGSDEDMAQCK
NFTHCSFDYDLCDWEAAAGPPVWGRNTSLNLGISYSIPTRDHSNNSRAGFFLHVSSDRTG
GTAQLSSPTFQATNSCSLVLYCHLHGSATSNLSISYVTNSTKHLMRERIGDLGSCWVRER
VDFNVTDPFKVLIEGVAGSGGTVAIDDLILSQGCVKEQGELVGSVLHPAPPLVTLPSQAG
ASPCAADEVSCASGDCIAAELACDFADTCADGSDEKHCGTTTFESGAGGWHDVSVGRLRW
Download sequence
Identical sequences H0YW58
ENSTGUP00000002531 ENSTGUP00000002531 59729.ENSTGUP00000002531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]