SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002535 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002535
Domain Number 1 Region: 236-387
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.86e-23
Family MAM domain 0.013
Further Details:      
 
Domain Number 2 Region: 29-186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-22
Family MAM domain 0.016
Further Details:      
 
Domain Number 3 Region: 417-451
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000072
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 4 Region: 194-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002535   Gene: ENSTGUG00000002460   Transcript: ENSTGUT00000002559
Sequence length 473
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:310465:314877:-1 gene:ENSTGUG00000002460 transcript:ENSTGUT00000002559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCNFVCDCSDCSDENQCGYLRGSAVLGTPFTCDFEDSDCGWQDVGTSMYGWVRGRASLAT
WGMGPHSDHTVGTDLGKSMEGGSSAAKIAATAWLRSPEMREAAATCEIRTWYHLSGSWRP
VLRLAVAHKDEVVELWQSPERSSEGWHQLVAYPGRIMDQFQLIFSLTQPPTCGAEVALDD
IMFRNCGLPEVGQQACGAQASRCHRGSCLEQQRFCDGTDDCGDGSDEDMAQCKNFTHCSF
DYDLCDWEAAAGPPVWGRNTSLNLGISYSIPTRDHSNNSRAGFFLHVSSDRTGGTAQLSS
PTFQATNSCSLVLYCHLHGSATSNLSISYVTNSTKHLMRERIGDLGSCWVRERVDFNVTD
PFKVLIEGVAGSGGTVAIDDLILSQGCVKEQGELVGSVLHPAPLLLGPKPLVTLPSQAAD
EVSCASGDCIAAELACDFADTCADGSDEKHCGTTTFESGAGGWHDVSVGRLRW
Download sequence
Identical sequences H0YW62
ENSTGUP00000002535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]