SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002556 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002556
Domain Number 1 Region: 2636-2686
Classification Level Classification E-value
Superfamily UBA-like 0.00000000488
Family TS-N domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002556   Gene: ENSTGUG00000002472   Transcript: ENSTGUT00000002581
Sequence length 3489
Comment pep:novel chromosome:taeGut3.2.4:21:1151549:1201196:1 gene:ENSTGUG00000002472 transcript:ENSTGUT00000002581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEGLVAWVLNTYLGKYVNNLNTDQLSVALLKGAVELENLPLKKDALKELELPFEVKAGF
IGKITLQIPFYRPHVDPWVISVSKLHLIGAPEKREEFDEEKEKLQEREHKKALLLALEEK
WKKEQQQKGESYWYSVTASVVTRIVENIELKIQDVHLRFEDGVTNPSQPFAFGICIKNVS
MQNAVFEPVEKLMRKKRMDVGDFSVYWDTSCTLLGDLPPGELQEAMDRSMESRDHNYIME
PVCTSALLKRNCSKEPLRSRHTPRLECDIQLETIPLKLSQMQYQQIMGFLKELARKERQL
KYRKWKPKVTVTENCREWWIFALNANLSEIREQRKRSTWAFALHRARDAVSYTDMYYSKL
KGEPLSAADQAEMHRIEDELTYEELKVLYEIVHNKFHDLAESVKEPLPDSIGGSPPAEPA
RDSSSGMLQYLQSWFPGWGGWYGYAQQTYEGEPFEGLLPDPKEQWNPEDILVGTDEFFDP
AADASSMNTFTKRDHVFAKLNLQLQGGSFTLLHRKKKVLRAEETAFMQLEFSGVKILAES
LPRRKSSLLKIQLGGLFVRDLATEGTIFPVLVFPNPQKEVGCMSSFGLQSLSSEMTNQST
DYVADPDAPVFEMLYERNPIHSTFERRLEVSTRPLNIIYNPQAIKKVADFFYKGRVHTSG
FGYQSELEARVAEAARRQYNKLKMQTKAEIRQTIDRLLVGDFIENSKSWTVCLDISAPQV
IFPDDFKFVDPVLVVVDLGRILLTNSQEDSERSAGAISSEVNELSDEEYKTPLATPPNTP
PPESNTNSCIKMSEFTGVEISEEQLQAHLMSKKMYERYTLSFMDLQIMVGRVKDNWKHVQ
DSDVGPTHVVEKFNVHLQLEHRLIYTSDPKYPGAVLSGNLPDLKIHINEDKMLALRNCLT
QLSTSEAKSSDALHLGKDKIFAEVDQFGSLHDSVMNLTQSVVMLEQHTREVLVESQLLLA
EFKVNCMQLGVESNGRYISVLKVFGTNAHFVKRPYDAEVSLTVHGLLLVDTMQTYGTDFD
LLMASHKNLSFYVPTGSLRDSRAQSPVSGPQDTHPIDVAGLAEGCSTASNTSPSNNGKEQ
ESLIKLEYQFVSAECPSMNLDSSLQVISLQVNNLDIILNPETIVELIGFLQKSFPKEKED
SSPQPLIADWERGWREQETFQSTYAQNTEVAVDIHWLNVLLLRTVAMTNGEKYGRKIATA
SIGGTKVNVSMCSKLDVSGSLGCLHLMDLIQDNVKNQYVVSIGSTGRCENLTGNVNVFES
LFFRLDDGSSLPDALSFTFTEKSKEECSLNLKMASLHYNHSAKFLKELTLSMDELEENFR
SMLKSAASKVTTVLATKTAEYSEMVSLFDTTPRSRDVASAEDNEGGAFGSQSFRADTIKL
ILNINIESPIVSIPRKPGSSELLVGHLGQISIQNFVPGEDESTSDRLQVEIKDIKMYSLN
SSQFTNKKEPASGLPRGPHSSSGPASTNSQEESHFTRHDFFESLHKGHAFHILNNTTIQF
KLEKIPLEKDLDLTFPLCNEDFGISSIMKIEGKFVNPLQVVLAKHVYEQVLQTLDNLIYS
EDLNKFSATSVSPTSLSSPSSSLHSTGTEFLSERKENGLFSHSSFNSVPNKPLTIRETKS
FTQIQANFHISELQVQLSGDLTLGAQGLVSLKFQDFDVEFAKDHPQTLSIQIALRSLLME
DLLEKKPDSKYKNLMVSHGAPKPSSLAHKEYLSQSCPSVSNAEYPDMPRSLPSHMEEAPN
VFQLYQRPVCASRKKQKEDADSEYPLTPPPSPSADRSKLPCGKSNFDDSLVHINIFLVDR
KHPEFSSRYNNINRSVDVDFNCLDVLITLQTWVVILDFFGIGSTADNHAMKPQPEDTQQT
IKAEINSLSASQVQEPVNTKLDLKVHSLSLVLNKTTGELAKASVAKLAAHLEVIEGDLAL
QGSIGSLSLSDLTSHGEFYRERFTTSGEEALIFQIFKYGRPDALLQRECDVRVTLRMASV
QYVHTQRFQAEVVAFIQHFTQLQDVLGRQRAAIEGQTVRDKAQRASRVLLDIEAGAPVLL
IPESSKSNSLIVANLGKLKVKNRFLFAGMPGTFSLKNKDSVQFSSPMGTPKHSVKKTSAD
EPKLAIEGLVMKKSSGTNISRLKSEPAVGTSSKQQGQPSKLPVVPNPESPEDHICLLDCI
VVDLQDMDIFAAERYQREYSKAVEDTSADLSFPSYLVRQTGGSLLTEPFRLKLKVERNLD
KELSHAVADISIHGNLSSVHCSLDLNKYKLIRGLLENNLGEPIEEFMRPYDLQDPSILTV
LSGEVYTSMSFLIDMVNVSLELMDPKGKDGCSSLARFDFKKSKLLFESSSDGTKSVNLVS
HSMMAFDTRYAGQKYATGPPNVFNCIFQSSKNTSSPGAIQIELHFRSTKDSSSFTVVLNN
LRVFLIFDWLLLVHDFLCTPGDTKKREHPHPSRQRACISDTTVVPKTVKSGVVTKRSSLP
VTAEKQLEVKVNVTGTEFVVVEDMSCFDTNAIILKGTTVLTYKPKLLDRPFSGSLFGIEV
FSCRLGNEQETALSIIDPVQIHMELIGNSSYPIGSGLLDAFNSEDFPPILEIQLQALDIR
LSYNDVQLFLAIAKSIPQQTSAALPDSAASSAGNAADASSSALGHENSLAHESRDGSKRV
LDPVLEVQLARLQELGFSMGDCRKALLICQGDLKKAASWLFKNAEPLKSVSQTSGRDSQG
ILPFQFISGVEINAESICICFIDDCMDCDVPLAEITFSCLNFLQHLRTSPEGYARFTLSG
DYYNRELSGWEPFIEPWPCYVSWQQEALSRLQPSRLKLEVKAKPRLDINITSVLIEQYTC
TKQSWMEDYCKQDKEVNVISSEDWMGSSVDPPCFGQSLPLVYLRTRSTASLTNLEHQIYA
RAEMKTPKRRQPFVPFALRNHTGCTLWFATLTTTPTRAALSHSGSPGVVPEENGTLLGDA
HNVSEWQEVITGEEVPFEFETRGKLRHRHTHDLRIHQLQVRVNGWEEVSPVSVDKVGTFF
RYAAPDKNSSSSTLGSPISRTNIIHPQVYFSSLPPVRVVFEVTMEGSARKVITVRSALML
KNKLEVPMELRLDSPSAPDKPVVLPAVMPGDSFAIPLHLTSWRLQARPKGMGVFFCKVPI
HWTNVQKAAEVCSSKRECHSMETENSRFFRFCVAIKKENYPDYMPSSIFSDSAKQIFRQP
GHTIYLLPTVVICNLLPCELEFYVKGLPIGGTLKPGKEAALHTADTAQNIELGVLLENFP
ICKELLIPPGTQNYMVRMRLYDVNKRLLNLTIRIVCRAEGSLKILISAPYWLINKTGLPL
IFRQDNAKTDAAGQFEEHELARSLSPLLFCYADKEQPNFCTMRVGKGIHPEGMPGWCQGF
SLDGGSGVRALKVIQHGNRPGLIYNIGIDVKKGRGRYIDTCMVTFAPRYLLDNKSSYKLA
FVQREFARGQGTSNPDGYISTLPGSSVVFHWPRNDYDQLLCVRLMDVPNCIWSGGFEVNK
NNSFHINMR
Download sequence
Identical sequences H0YW83
ENSTGUP00000002556 59729.ENSTGUP00000002556 ENSTGUP00000002556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]