SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002570 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002570
Domain Number 1 Region: 2690-2978
Classification Level Classification E-value
Superfamily BEACH domain 3.66e-126
Family BEACH domain 0.000000014
Further Details:      
 
Domain Number 2 Region: 3049-3248,3413-3445
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.18e-29
Family WD40-repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 2536-2658
Classification Level Classification E-value
Superfamily PH domain-like 4e-23
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 4 Region: 3453-3521
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.88e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 
Domain Number 5 Region: 1087-1285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000391
Family Trypanosoma sialidase, C-terminal domain 0.062
Further Details:      
 
Domain Number 6 Region: 470-514,579-657,712-753,873-906
Classification Level Classification E-value
Superfamily ARM repeat 0.000071
Family Armadillo repeat 0.063
Further Details:      
 
Domain Number 7 Region: 2345-2405
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000748
Family Retinoblastoma tumor suppressor domains 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002570
Domain Number - Region: 1409-1460,1512-1578,1615-1705
Classification Level Classification E-value
Superfamily ARM repeat 0.000357
Family HspBP1 domain 0.048
Further Details:      
 
Domain Number - Region: 122-414
Classification Level Classification E-value
Superfamily ARM repeat 0.0121
Family Armadillo repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002570   Gene: ENSTGUG00000002468   Transcript: ENSTGUT00000002596
Sequence length 3529
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:10141375:10244587:1 gene:ENSTGUG00000002468 transcript:ENSTGUT00000002596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEDCSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPSTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEVNQSEEA
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHVPEVVGGAQNELPLA
ERRALLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLPWRKSAGEVLM
TISRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLEIVEMFAGLSCFLKDSSDVSQTL
LDDFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNLITSLTTYGVNELKPAGVTTGVP
FLLPGFAVPQPAGKGHSVRNIQAFSVLQNAFLRAKTNYLAQIILDAITNIYMADNANYFI
LESQHTLSQFAEKIPKLPEVQTKYFEMLELVVFSLNYIPCKELISVSILLKSSTSFQCSI
IAVKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAALLKDPAQALNDQGNSRNSSFED
QKQLALLVMETLTVLLQGSNTNAGIFREFGGARCVHNIVKYPQCRQHALMIIQQLVLSPS
GEDDMGTLLGLMHSAPPTELQLKTDILRALLLVLRESHRSRTVFRKVGGFVYVTSLLVAM
ERSLCSPPKNGWEKVNQNQVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVRL
LGCFSDLRKISPLNVFPSNTQLFQRLLDDDLISLDSVSPTLRHCSKLFIYLYKVATDSFD
SHAEQIPPCLTNETSLPSPWGTPALSRKRHAYHSVSTPPVCPQKNIADVKLQTGSMSIQS
SDAVIIHPGAMLAMLDLLASVGSATHPEHALDLQLAVANILQSLVHTERNQQVMCEAGLH
ARLLQRCSAALADEDHSLHPPLQRMFERLASQALQPMVLREFLRLGNPLNCGAWDKKLLK
QYRVHKPSSLSFEPEMRNSMVTSVEGLGPDSVFSVHEDSHYRISKSLLKPAEGSTVPLTR
VKCLVSMTTPHDIRLHGSSVTPAFIEFDTSLEGFGCLFLPSLAPHNAPTNNAVTTGLVDG
AVVSGIGTGERFFPPPSGLSYSTWFCIEHFSTPPNNHPVRLLTVVRRANSSEQHYVCLAI
VLSAKDRSLIVSTKEELLQNYVDDFSEESSFYEILPCCARFRCGDLIVEGQWHHLVLVMS
KGMLKNSTAALYLDGQLVNIVKLHYIHSSPSGSGSANPPVVSTVYAYIGTPPAQRQLSSL
VWRLGPTHFLEEVLPAPGVSTIYELGPNYVGSFQAVYVPCKDSKSEGINPSPVSLVPEER
VSFGLYALSVSSFTVAKIRKIYNKLDSKAIAKQLAISSHENATPVKLLHNSAGHLNGPAR
SLGAALIGYLGVRTFVPKPVATTLQYIGGAAAILGLVAMASDVEGLYAAVKALVCVVKSN
PLASKEMERIKGYQLLAMLLKKKRSLLNSHILHLTFSLVGTVDSGHETSIIPNSAAFQDL
LCDFEVWLHAPYELHLSLFEHFIELLTESSEAAKNAKLMREFQLIPRLLLTLRDMSLSQP
TIAAISNLLSFLLQGFPSSYDLLRSRFGQFISSTLPTFAVCEKFVVMEINNEEKLDSGTE
DDFGGLVSANLILLRNRLLDILLKLLYTSKEKTTVNLQACEELVKTLGFDWIMMFMEEHL
HSTTVTAAMRILVVLLSNQSILMKFKEGLSGGGWLDQTDSVLTNKIGTVLGFNVGRSAGG
RSTVREINRDACHFPGFPVLQSLLPKHTNVPALYFLLMALFLQQPVTELPENLQVSAPVI
SSQYNQGAKFDLDSIWTFIFGVPASCGTVTSSIHSVCTEAAFLLLGMLRSMLNSPWQSEE
EGSWLREYPVTLMQFFRYLYHNVPDLISLWMSPEFLCALAATVFPFNIRPYSEMVTDLDD
EAGSPAEEFKAFAADSGMNRSQSEYCNVGTKTYLTNHPAKKFVFDFMRVMIIDNLCLTPA
SKQTPLVDLLLEASPERSTRTQQKEFQTYVLDGVMDHLLAADVLLGEDASLPITSGGSYQ
VLVNNVFYFTQRVVDKLWQGMFNKESKLLVDFIIQLIAQSKRRSQGLSLDAIYHCLNRTI
LYQFSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCLAHCLINLHVGSNVDG
FGLEAEARMTTWHIMIPSDIEPDGVYNQDVSEGRQLLLKAINRVWTELIHSKKQVLEEVF
KVTLPVNDCGQVDITVARPFIEEASLKCWQNHLAHEKKCISRGEALVPTTQSKLSRVSSG
FGLSKLTGSRRNRKESGLSKHNLSTQEISQWMFTHIAVVRDLVDMQYKEYQERQQNALKY
VAEEWSQIEYELLRERGLWGPPIGSHLDKWMLEMTEGPCRMRKKMVRNDMFYTQYPYMPE
AEQETNLTSDFSNRIPETSDDTISQKKPARYRRAISYDSKEYYMRLASGNPAVFQDAIEE
NTVGETAPQEPEHGEDTIARVKGLVKPPLKRSRSAPDGGDDENQDQSQDQIVEGSSIDEE
EKTDNTTLLRLLEEGEKIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGFTMTATREIRD
IETLPPKMHEPIIPRGARQGPSQLKRTCSIFAYEDIKEVHKRRYLLQPIAIEVFSGDGRN
YLLAFQKGVRNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRW
ERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEELDLTNPKTFRNLAKPMGA
QTEDRLAQYKKRYKDWEDPNGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHF
DLADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLLNSNNFDLGCKQNGTKLGDVI
LPPWAKGDPREFIRVHREALECDFVSARLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEG
QVDIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPKRVRSRLNGEAVGTSVPPGSTGD
KIFFHHLDNLRPSLAPVKELKEPVGQIVCTDKGILAVEQNKVLIPPTWNKTFAWGYADLS
CRLGTYESDKAVIVYECLSEWGQILCAICPNPKLVITGGTSTAVCVWEMGVSKEKAKALT
LKQALLGHTDTVTCLTASLAYHIIVSGSRDRTCIIWDLNKLSFLTQLRGHRAPISALCIN
ELTGDIVSCAGTYIHVWSINGSPTASVNTFTGRSQQIMCCFVSEMNEWDTQNVIITGHSD
GVVRFWRMEFLQVPETPAPEPVEVLEMQEDCQDAQIGQEAHEEDSSDSEADDACIGQDAK
VQESQSQPSSTSHRPRSASARAVAAWSADSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQA
KMHPHAQVNHPHPSYGEARHYSKLKPGHRWERQLVFRSKLTMHTAFDRKDNAHPAEITAL
GISKDHSRILIGDGRGRVFSWSVSDQPGRSAADHWVKDEGGDSCSGCTVRFSLTERRHHC
RNCGQLFCQKCSRFQSEIKRLKISSPVRVCQNCFYNLQHERGSEEGPRN
Download sequence
Identical sequences H0YW97
ENSTGUP00000002570 59729.ENSTGUP00000002570 ENSTGUP00000002570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]