SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002619 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000002619
Domain Number - Region: 75-173
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.0436
Family Gonadodropin/Follitropin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002619   Gene: ENSTGUG00000002552   Transcript: ENSTGUT00000002647
Sequence length 206
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:48063637:48066468:-1 gene:ENSTGUG00000002552 transcript:ENSTGUT00000002647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPAIHFYGFLLACIFTRSYLAFKNDATEILYSHVVKPAAASPSSNSTLNQARNGGRHY
TSTGSDRNNRVQVGCRELRSTKYISDGQCTSINPLKELVCAGECLPLPLLPNWIGGGYGT
KYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSIRTYKITVVTACKCKRYTRQHNESSHNFE
GTSQAKPIQHHKERKRASKSSKHSTS
Download sequence
Identical sequences A0A218V929 H0YWE6
XP_002188309.1.42559 XP_005518902.2.90289 XP_009084264.1.15306 XP_021393969.1.53032 ENSTGUP00000002619 ENSTGUP00000002619 59729.ENSTGUP00000002619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]