SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002621 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002621
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.41e-19
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002621   Gene: ENSTGUG00000002550   Transcript: ENSTGUT00000002649
Sequence length 114
Comment pep:known_by_projection chromosome:taeGut3.2.4:4A:5099880:5127030:-1 gene:ENSTGUG00000002550 transcript:ENSTGUT00000002649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIKVYIASSSGSTAIKKQQQDVLGFLEANKIEFEEKDIAANEENRKWMRENVPEDSRPA
SGNPLPPRLFNDSRYLGDYDAFFEARENNAVYAFLGLTAPPGSKEAEALAKQQA
Download sequence
Identical sequences H0YWE8
ENSTGUP00000002621 59729.ENSTGUP00000002621 ENSTGUP00000002621 XP_002187246.1.42559 XP_005526183.1.90289 XP_009088671.1.15306 XP_014123403.1.73095 XP_015482226.1.82291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]