SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002654 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002654
Domain Number 1 Region: 38-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.68e-19
Family Thioltransferase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002654   Gene: ENSTGUG00000002580   Transcript: ENSTGUT00000002682
Sequence length 166
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:48263493:48270109:-1 gene:ENSTGUG00000002580 transcript:ENSTGUT00000002682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMLHSTLALSLLLIAVNSNLAMAIKKEKRAPQTLSRGWGDEITWVQTYEEGLYQAKKSNK
PLMIIHHLEECQYCQALKKAFAENEEIQEMAQNNFIMLNLMHETTDKNLSPDGQYVPRIM
FVDPSLTVRADITGRYSNRLYTYEPQDMMFLIENMKKALRLIQTEL
Download sequence
Identical sequences H0YWI1
ENSTGUP00000002654 59729.ENSTGUP00000002654 ENSTGUP00000002654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]