SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002672 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002672
Domain Number 1 Region: 468-695
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.78e-57
Family Eukaryotic proteases 0.0000000341
Further Details:      
 
Domain Number 2 Region: 84-184
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-36
Family Kringle modules 0.0000128
Further Details:      
 
Domain Number 3 Region: 181-265
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-33
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 4 Region: 272-356
Classification Level Classification E-value
Superfamily Kringle-like 1.28e-32
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 5 Region: 351-449
Classification Level Classification E-value
Superfamily Kringle-like 1.18e-26
Family Kringle modules 0.00059
Further Details:      
 
Domain Number 6 Region: 7-96
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 4.71e-24
Family Hairpin loop containing domain 0.0000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002672   Gene: ENSTGUG00000002584   Transcript: ENSTGUT00000002700
Sequence length 701
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:9584500:9625926:1 gene:ENSTGUG00000002584 transcript:ENSTGUT00000002700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGKGKKRSPLHDFKKTGELMLIKVNKTLEVKTKLLNTTEQCAKRCSRNKGLSFTCKAFAY
DRVTKRCHWLSFNSLTNGVRKKQDHAFDLYEKKDYVRNCIIGKGADYKGTISVTKSGIQC
QAWNSMIPHEHSFLPSSYRGKDLRENYCRNPRGEEGGPWCFTTSPETRHEVCDIPLCSEV
ECMTCNGESYRGPMDHTETGKECQRWDLQRPHKHKFRPERYPDKGFDDNYCRNPDGKLRP
WCYTLDPNTPWEFCAIKTCEESTVNRTEATAETTACVRGQGEGYRGTVSTIWSGIQCQRW
DSQFPHQHNITPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRIGYCSQIPKCDVSNEQ
DCYRGNGKTYMGNLSKTRFGLTCSAWDKNIEDLRRHIQIFREPDVSKLKKNYCRNPDDDF
HGPWCYTDDPLVPWDYCPISRCEGDTTPTTTSLDDTAIPCASTKHLRVVNGIPTQTNEGW
VVSLTYRNKHICGGTLIKEEWVLTARQCFPSRYKDLKDYKAWLGVHNIKGKGEEKRKQVR
NISQLVYGPTGSDLVLLKLSRPAILTNFVEIIRLPISGCTIPEKTSCSVYGWGYTGLVNY
DGLLQVANLFILGNEKCNQYLKGKITVNESEICAVAETIGAGPCERDYGGPLVCEQNRLK
IVTGVIVPGRGCAIRNRPGIFVRVSYYSRWIHKIMMTYRKP
Download sequence
Identical sequences H0YWJ9
ENSTGUP00000002672 ENSTGUP00000002672 59729.ENSTGUP00000002672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]