SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002680 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002680
Domain Number 1 Region: 375-593
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-52
Family DBL homology domain (DH-domain) 0.0000935
Further Details:      
 
Domain Number 2 Region: 598-726
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-23
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 3 Region: 127-200
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000032
Family Ras-binding domain, RBD 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002680   Gene: ENSTGUG00000002606   Transcript: ENSTGUT00000002708
Sequence length 942
Comment pep:known_by_projection chromosome:taeGut3.2.4:21:2175909:2184327:1 gene:ENSTGUG00000002606 transcript:ENSTGUT00000002708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEPCPEEETVLHCQNPDCAGERRAAKECHHAECRQLSRSGPLSLCELCDGRLHGAMHFDG
HIRFDLSPQGSILARNMSTRSCPPRTSPASDVEEEEEGLAESRGERRAHLKLPKKKAWRR
HTDDPSKECFTLKFDLSIDMEAEIVPAVKKKSLGEVLLPVFERKAIELSKVNIYLDQSHT
PLSLQFEAYRFGGHYLRVKGDAPTAKPGDELKVEQAVRDARSASLPILRPASSAAFLGPV
LEPLPGRREGTESMAPGRRRKNITEFLGDSNIPSPEPALHSSSSLPTNGTDTWKNRAASR
FSGFFGSGTSTGSFGRETEKLEQLVNRLHAYSTFGLPKLPPQLRFDRDSWEEDGDEAGLT
LEDSWQQIIQGTEVLSRRQCHQQEAIWELLHTEATYIRNLKVITDLFLSCLVNLQESGLL
CEVDAERLFSNIGEIIRLHCKLWRSVMASVLAKARRTGALLDPIDFLDGFKMFGSLFKPY
VQYCMEEEGCMEYMRTLLRDSELFRTYVTWAEKQEQCSRLKLSDMLVKPHQRLTKYPLLL
KSILKKTDDPHARDAITTMISSVERFINDVNSRMRQRQERQRLDAILSRIDAYEVVEGST
DEVDKLLKEFLRLDLTAPIPGTSPEDTRQLLLEGSLRMREGKDSKMDVYCFLFTDLFLIT
KPFKKAERTKVIRQPLLVDRVVCRELRDPGSFLLIYLNELGSAVAAYTFQTSGQLCRSWV
EAVRNAQVRAHGWLWDPWNLLQRLRQRRRMEEQEEEDEEDEEDDGESGTSAASSPTILHH
SSASPDSQQCPSDGSTETLAMVAADGGDELSSPDWDAGPFSSTSDGSSVSTSTSIGTGTS
ELPAGSGCRSSSIDSAYGTLSPASLRDFGQQPEGTAEEGQEPSLAPPAPRPASPRLRRRT
PVQRLPCPARVLKSKSEASLPQLLSPTSSGPLSQSRSLSDLC
Download sequence
Identical sequences H0YWK7
ENSTGUP00000002680 ENSTGUP00000002680 59729.ENSTGUP00000002680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]