SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002689 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002689
Domain Number 1 Region: 171-338
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-40
Family SPRY domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002689   Gene: ENSTGUG00000002617   Transcript: ENSTGUT00000002717
Sequence length 343
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:1282199:1290655:-1 gene:ENSTGUG00000002617 transcript:ENSTGUT00000002717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPAALSQNKLVERCERIQLQSAAIARHVDEVLPAKDQGVLSAASAARELVVQRLLLVGK
ACENEEQRLLERVHAEEERVHQSILTQQVHWTEALHKLGALRTYLVDMITNLDDQGLLRA
EQEIFERTEVAEGILEPQESLKLNFNQTCVQSPLLHRLWACAVLCCLTGSQEIHIDEKTL
SPHLSLSEDKRTLTFSPKKAKVDSGCPERFDHWPNALATAPFHSGVCAWKVSVEQSCAYK
LGVCYSSVPRKGSANEGRLGFNAASWVFSRYDKEFRFLHAGQPQPVELIKAPAEIGVLLD
FAGGELLFYDPDSCAILFSHRQAFLEPVYPVFAVAHQSISLGR
Download sequence
Identical sequences H0YWL6
59729.ENSTGUP00000002689 ENSTGUP00000002689 ENSTGUP00000002689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]