SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002725 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002725
Domain Number 1 Region: 131-203
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 193-253
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000243
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 7-68
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000324
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 4 Region: 68-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000865
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002725   Gene: ENSTGUG00000002646   Transcript: ENSTGUT00000002753
Sequence length 441
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:8500556:8529750:1 gene:ENSTGUG00000002646 transcript:ENSTGUT00000002753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFDDLQACADPGAPEHGYKTPSAGVFFESVVVRFHCQEGYRLNGTSKKLCVRHFNGSLSW
KPSDKPVCLQEDCLVPHVEDAEVHNKTYRTGDKLIISCHEGFQIRYPDLDNMVSICQDDG
TWDNLPICQGCLRPLVLPHSYINISEFGASFPVGTVVHYQCFPGYKLEGAEILECMYNLI
WSDSPPRCLDVEVCPLPPMVSHGDYICHPRPCERYNHGTVVEFYCDPGYTLTNDYKYITC
QYGEWFPSYQVYCVKTEQTWPNTQETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKT
HFLPRGNQEGSMGDPDFVVVDGVPVMLPSYDEAVSSGLNALAPGYSAATDQGHILQSEDQ
NPPAYPGPRIPDTQPSEFEACDSRLGSSELLQSLYPSLTCQAAAPPGSDRTDVSHSTDED
AASTSPRIDITDEIPLMEEDP
Download sequence
Identical sequences H0YWQ1
ENSTGUP00000002725 ENSTGUP00000002725 59729.ENSTGUP00000002725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]