SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002728 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002728
Domain Number 1 Region: 870-1140
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.99e-71
Family Tandem AAA-ATPase domain 0.0000342
Further Details:      
 
Domain Number 2 Region: 605-868
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.44e-55
Family Tandem AAA-ATPase domain 0.000049
Further Details:      
 
Domain Number 3 Region: 255-321
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.64e-17
Family PHD domain 0.0019
Further Details:      
 
Domain Number 4 Region: 509-581
Classification Level Classification E-value
Superfamily Chromo domain-like 2.02e-16
Family Chromo domain 0.0044
Further Details:      
 
Domain Number 5 Region: 398-485
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000334
Family Chromo domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002728
Domain Number - Region: 85-124
Classification Level Classification E-value
Superfamily HMG-box 0.000377
Family HMG-box 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002728   Gene: ENSTGUG00000002634   Transcript: ENSTGUT00000002756
Sequence length 1820
Comment pep:novel chromosome:taeGut3.2.4:21:2227790:2245634:1 gene:ENSTGUG00000002634 transcript:ENSTGUT00000002756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMSENEEEIEEKSESEGSDYSPNKKKKKKLKDKKEKKPKRKKKDEEEDDNEDGSLKEPKS
SAQLMEEWGLDDVDYVFSEEDYHTLTNYKAFSQFLRPLIAKKNPKIPMSKMMTVLGAKWR
EFSANNPFKGSSAAAAAAAVAAAVETVTIAPALPASPQHSALPAVVRKAKTKEGKGPGVR
KKIKGSKDGKKKGKGKKMAGLKFRFGGIPSKRKKGSSSEEEEREESDFDSASINSSSMRS
ECSAGLGKRGKKRKKKKRIPGEESFEEGDGYETDHQDYCEVCQQGGEIILCDTCPRAYHL
VCLDPELEKAPEGKWSCPHCNAGILAWVSDGMSSHVYMWPMERGLFCLVARPVPVGDAKV
STDTSQAPCSGCSPSAPQFPALVPPWLLAGSHLKLLPCPPLKGKVQRILHWAWREPPAAP
LPPVLPAADPQPVLPPPKVLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQ
RKNDMDEPPAFDYGSGDEDNQREKRKNKDPQYAKMEERFYRYGIKPEWMMIHRILNHSFD
KKGDIHYLIKWKDLPYDQCTWEIDDIDIPYYENLKLLYWNHRELMLGEDTRPLKKLNKKG
KKLKEEKLEKPPETPLVDPTVKFDKQPWYIDATGGTLHPYQLEGLNWLRFSWAQGTDTIL
ADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEMWAPDFYVVTYTGD
KESRSVIRENEFSFEDNAIRSGKKVFRMKKEAQIKFHVLLTSYELITIDQAVLGSIEWAC
LVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEG
FLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFI
LTRNFEALNSKGGGNQVSLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGNSLVKSS
GKLMLLQKMLKKLRDGGHRVLIFSQMTKMLDLLEDFLEYEGYKYERIDGGITGGLRQEAI
DRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKV
MIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELDDILKFGTEELFKD
DVEGDNKDVDDSSVIHYDDAAISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVREEDG
VEEVEREIIKQEENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNYNDTSQEDQE
WQDELSDNQSEYSIGSEDEDEDFEDRPEGQSGRRQSRRQLKTDRDKPLPPLLARVGGNIE
VLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEKEFRAYVSLFMRHLCEPGA
DGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYSTPDLLLEGPESKRSS
EVVSSDPNTPVPASPAHTHTGPGVLAEAQLGFHEEKDPVEQKPRKVSDSQVSISSRNAEV
ESEEHPESCDSKERPRKEKQEDCEKAEPSSEPLVKGEALPAEIPEKTSCLFPPADEGIQE
QEKPLEKAELSSSQGKGEDKEDGKEEEKEPSDAQQNGDKEEEEDGKKDDRNTSRFMFNIA
DGGFTELHTLWQNEERAAMSSGKIYDIWHRRHDYWLLAGIVTHGYVRWQDIQNDPRYVIL
NEPFKSEIHKGNYLEMKNKFLARRFKARLLEQALVIEEQLRRAAYLNMTQDPSHPAMALN
ARLAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIP
PVAARLQMSERSILSRLATR
Download sequence
Identical sequences H0YWQ4
59729.ENSTGUP00000002728 ENSTGUP00000002728 ENSTGUP00000002728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]