SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002789 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002789
Domain Number 1 Region: 11-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.63e-52
Family APC10-like 0.0000000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002789   Gene: ENSTGUG00000002709   Transcript: ENSTGUT00000002818
Sequence length 185
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:12589050:12615733:1 gene:ENSTGUG00000002709 transcript:ENSTGUT00000002818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDTHKKPIRTFMIQIAVLANHQNGRDTHMRQIKVYTPVEESSIGKFPRCTTVDFMM
YRSIR
Download sequence
Identical sequences H0YWW5
ENSTGUP00000002789 XP_012428778.1.42559 ENSTGUP00000002789 59729.ENSTGUP00000002789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]