SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002798 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002798
Domain Number 1 Region: 327-456,557-810
Classification Level Classification E-value
Superfamily Ras GEF 1.83e-99
Family Ras GEF 0.00012
Further Details:      
 
Domain Number 2 Region: 464-566
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.29e-32
Family Ras-binding domain, RBD 0.0000257
Further Details:      
 
Domain Number 3 Region: 25-144
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.01e-26
Family DEP domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002798   Gene: ENSTGUG00000002700   Transcript: ENSTGUT00000002827
Sequence length 811
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:50457347:50588268:-1 gene:ENSTGUG00000002700 transcript:ENSTGUT00000002827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTLSRRISNPYLETPSNKIYGESSSCAGRALRNIFTLQASDLIKDRVYLTGICRRSCVGS
ELVDWLLEQCPFVKCRSTAVGVWQLLLDMGIILSVDRQLYFQDSHVFYQFSADECTYLFC
EFEKEEAWKNGVKLLLQLLPLSPPRIDMCNLPDQKIEDTAETNAEILARLTSAVQRELAA
VIALKARKSVSLQIKLNQGKKVSVIPKFFGPDSKDAGVLCKLQGRDDIGRIELVQKLARE
NCQFLQADRKALEKAEQVDDGGGGERARDAAGSALVLRKVWSRSPAPYRLGIEKGGGYIV
AKEIPLYFLLVLANVLYLGLFLSSSAETLLDDFLLTYTVFMTTDDLCQALLRQYPFTEAN
HQGKEDDSDVSCRKRKVLHLVSQWTSLYKDWLHEDEHLKQFLKTIYRNVLDDVYEYPVLE
KDLKEFQKILGMHRRHTVDEYSPHRKNKTFFQQFSVKENWLQHRGTVNETEEIFCRVYIM
EHSYVSVKAQVSTSAQEILKIVAEKIQYPEEELALVTVSFSGEKHELQPNDLAISKSLES
SSRMFVYRKDLTDSLSPFSENEELQQRSVRILGINTWDLALELTNFDWSLFNAIHEQELI
YFTFSRQGSAENTENLSLLLQRCNEVQLWVATEILLCSQLCKRVQLVKKFIKIAAHCKAQ
RNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFAELESLTDPSLNHKAYRDAFKKMK
SPKIPFMPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRSLRHCRNNQFGNEVPSKE
HHELKPYVHHLHVIDNQQALFELSHRIEPRV
Download sequence
Identical sequences H0YWX4
59729.ENSTGUP00000002798 ENSTGUP00000002798 ENSTGUP00000002798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]