SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002817 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002817
Domain Number 1 Region: 13-69
Classification Level Classification E-value
Superfamily L domain-like 0.000000146
Family Internalin LRR domain 0.037
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002817
Domain Number - Region: 265-317
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00837
Family B3/B4 domain of PheRS, PheT 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002817   Gene: ENSTGUG00000002737   Transcript: ENSTGUT00000002846
Sequence length 395
Comment pep:known_by_projection chromosome:taeGut3.2.4:21:2566210:2569354:1 gene:ENSTGUG00000002737 transcript:ENSTGUT00000002846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPVSPAPFSLFSRLDAADNEVAELGADIAALPALKSLDVANNQLRELPAALADCPRLKEA
NFRGNQLRDKRLEKMVNGCQTKAILEYLRAGGRAKGKAESAREDVRKKKREKQKKDSGDG
EQDEVEEASKLLVKVLHVSENPAPLVVKVSPGVKDVRAFIVCCVLKGVNLKPGNALKRFL
TVQTKLHEDICEKRTVATIATHDLQLVKAPLTYDVQPPDELKIMPLGRKEIKAKDLLRQL
QLEAEEQRKQKKRQNVSGLHKYLQLLDGKDNYPCLVDAEGAVISFPPITNSEKTKIRKET
RDLFLEVTSDTSLQICKDVMDTLILKIAELNRSALENKEGSGSDMELDALCGPGNLNLPL
VVEQVRVVDTDGNLKVLYPSKTDLATVSSLLTVIR
Download sequence
Identical sequences H0YWZ2
59729.ENSTGUP00000002817 ENSTGUP00000002817 ENSTGUP00000002817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]