SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002826 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002826
Domain Number 1 Region: 674-782
Classification Level Classification E-value
Superfamily Second domain of FERM 1.16e-32
Family Second domain of FERM 0.00026
Further Details:      
 
Domain Number 2 Region: 784-890
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-27
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 3 Region: 1370-1464
Classification Level Classification E-value
Superfamily PDZ domain-like 9.6e-27
Family PDZ domain 0.0000572
Further Details:      
 
Domain Number 4 Region: 1091-1190
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-23
Family PDZ domain 0.016
Further Details:      
 
Domain Number 5 Region: 1503-1609
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-21
Family PDZ domain 0.039
Further Details:      
 
Domain Number 6 Region: 581-674
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.41e-19
Family First domain of FERM 0.008
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002826
Domain Number - Region: 2-155
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00247
Family Protein kinases, catalytic subunit 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002826   Gene: ENSTGUG00000002745   Transcript: ENSTGUT00000002855
Sequence length 1734
Comment pep:novel chromosome:taeGut3.2.4:4:13028606:13105821:-1 gene:ENSTGUG00000002745 transcript:ENSTGUT00000002855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEIWAILNQSAESLQELFRKVSITADPTALGFIISPWSLLLL
PSGSVSFTDENVSQQDLRAFTAPEVLQNYSLSSLSDFEKVHIYSLGMALFWGADHEVPQS
QPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKQLVRLVLGS
LSGMDQLSCNGDRKLQPDRSQAIRERLRGKGLPTGKTLTVDAPDGPRAHFSRQTTLNKGL
SKSMGFLSIRGTRDEEEFFQGISADYCSGQEDVFCPHRCKTSELQKKGHLHTDVPPKRKI
WASSTDLLCTTDKAAERDHAGGPHRHSHQCETFTVRTSTTARNKEERYSDGSIALDVFGP
QKLDQTRHIPETSTSAAISSAFDRIRERQKKLQLLREAMNVEEPLRRYKSYHSDVYSTSS
ESPSVISSEPDFRQGLLVRRNEAFKRDDASGVLSGADDISTSNQANSQRTSRQHEAPFEG
KLISQEVMLKRQEEEMMQLQARMALRQSRPNLYPGDAFRSSMLDITRDPLREIALETAMT
QRKLRNFFGPEFVKMTIEPFISLDLPKSILTKKGKSDDTRRKVNVMLLSGQKLELTCDTK
TICKDVFDMVVAHIGLVEHHFFGLATLRDNEFFFVDPDIKLSKVAPEGWKEEPKKKNKPP
VNFTLFFRIKFFVDDVSLIQHTLTCHQYYLQLRKDILEDRMHCDDETALLLASLALQAEY
GDYQAEVHGLSYFRLEHYVPARVLEKLDLSYTKEELPKLHSTYVGASEKETELEFLKLCQ
RLTEYGVHLHHVLPEKRSQTGILLGVCCKGVVIFEVHNGARTPVLHFPWRETKKISFSKK
KITLQNTSDGIKHSFQTDNSKTCQYLLHLCSSQHKFQLQMRTRQSNQDTQDIERASFRSL
NLHADSVKGFNMGRAISTGSLASSTLNRLAVRPLSVQAEILKRLSCSELSLFQPLPGSAR
DKNEKSPWEERPRVMSKSFHYLSQSHISVYPSKKNVITALDSSPKKIEDIMGRVFQQMPK
FDPGSATGELKPSNSKSHAGLSRSPERKKNESDSSSIEDTGQAYVVGQHAKNNITVFRNV
DFTVDSLQTTQNRVATPEREITLVNLKKDKKFGLGFQIVGGEKTGKLDLGIFIHSVIPGG
PADLEGTLKPGHRLISINSTSLEGVSQHAALEILENAPEGVTLVISQPKDKLSKASSNTA
HISNGARGYLRRPSSVQDNEAESSSEEHSRCRGHQRPASRSLSGLSGGKQDGSVSSQDSW
TESASLSQSQAASFFGKRASGRAQQDAQHCSESQAGASKAIEKRRSSSDSTRAKMKRPGV
VEPVEYSDRGDSDMDEATYSGSQEQQPAKKIKDSSSSNTANKVNSKKVSTTLLKPGDIFE
VELAKKDNGLGISVTGGVNTSIRHGGIYVKAIIPKGAAEADGRIEKGDRVLSVNGISLEG
ATHKQAVETLRNTGQVVHLLLEKGQLSGAKAHAPVTPQCTLPSQVGQCEPQEKPATESSN
AKDYSFVTAENTFEVKLLKNSSGLGFSFCREDNLTPEQLGSTIVRVKKLFPGQPAAESGQ
IEIGDVILKVNGASLKGLSQQEVISALRGTSPEVSLLLCRPPSGILPDIDPSLLTPIHSP
QQVFPEVSREVSGPSNREQGDSSDENETTDMSKKRLKSPSRRDSYSDSSRSGDEEMMESA
AQVGLGWSSALYQSSGEAEARAQSQYEAHPGQKDAVRTILYPDQEAPSKAELED
Download sequence
Identical sequences H0YX01
ENSTGUP00000002826 ENSTGUP00000002826 59729.ENSTGUP00000002826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]