SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002833 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002833
Domain Number 1 Region: 120-306
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-37
Family Laminin G-like module 0.0044
Further Details:      
 
Domain Number 2 Region: 10-146
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.69e-37
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00033
Further Details:      
 
Domain Number 3 Region: 306-489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-33
Family Laminin G-like module 0.0045
Further Details:      
 
Domain Number 4 Region: 934-1144
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-32
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 5 Region: 755-926
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.68e-25
Family Laminin G-like module 0.0052
Further Details:      
 
Domain Number 6 Region: 547-605
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000194
Family Fibrinogen C-terminal domain-like 0.003
Further Details:      
 
Domain Number 7 Region: 518-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000282
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002833   Gene: ENSTGUG00000002735   Transcript: ENSTGUT00000002862
Sequence length 1193
Comment pep:known_by_projection chromosome:taeGut3.2.4:27:2609963:2615943:1 gene:ENSTGUG00000002735 transcript:ENSTGUT00000002862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CYDELVAPLYSYSIGASSRYSIFYSASFARLHSTSGWSPDPADKQPWLQIDLMKKHRINA
VATQGTFNTYDWLTRYIVLYGDHPTSWKPFFQQGSNWTFFGNVNESGVVRHDLHYPILAR
YIRIIPVAWNPRGKIGLRLGLYGCPYRSHVLYFDGDDAISYRFRARRISTFEDDISFNFK
TLEQDGVLMHGEGSQGDYITVELKQAQLLLHISLGSSPLHASEGHTTVAVGSLLDDQHWH
SLHIERLGHYVNLTLDGEVKRFRCRGTFDQLDLETEVFFGGVIDHDKQHLTYRQNFRGCV
ENIMFNGVNIAELARHRRPNIRFEGKVGHYCQDQLTSPITFAGINNYVQVPGIPRRNRLA
VSFRFRSWDTAGLLLYTGFADRLGSLEMVLSEGQINVSIAQPGKKKLEFAAGHRLNDGFW
HSVHLVAREGSAVVTIDDDDGAEFRVAHPFQLRTGSQYFFGGCPKPASVTGCRSNQTAFH
GCLQMLNVDMQPVDVELLTLQRLAQYHNVFFNVCGITDRCTPNLCEHDSRCIQSWDDFMC
ICDLTGYKGETCHKSLYKETCDAYRVSGKTSGNYTIDPDGSGPLKPFTVYCDIREDRAWT
IIRHNRHYATRVTGSSVDQPYLGAVDYWNASWAEVSALANASEYCEQRIELHCYNSRLLN
TPSGLPFSFWMGRNDERHYYWGGSRPGIQRCACGLDKNCADPQYFCNCDADHAIWRTDKG
LLTFVDHLPVTQVVVGDTNRTGSEAQFVLGPLRCYGDRNTWNTVSFNRGAALIFPLQANH
SLDIFYFKTTAQSGVFLENPGYRNYIRIELNTTRDVAFIFDIGNGDENLTVRSVVPWNDD
EWHQVKAELNVKLARLRVDKLPWVVRPFPPQSFVRLEFDRPLYVGAAEYKMRPFLGCLRA
LRMNGVTLNLEGKANETEGVRVNCTGYCQDPPVPCQNSGLCVERYSHYTCNCSISAFTGP
FCNHDIGGYFEEGTWVRYNILPMSLYAAREFASIVSSPWQPLPGYNLTSEEVSFSFSTTS
APAVLLYVSTFVKDYMAVLIKDDGSLQLRYQLGTSPYVFTLTNKPVTDGRPHRVNITRLH
RTLYTQVDYLPIMEQQFSLFVDSKLDSPKNLYLGRVMETGVIDPEIQRYNTPGFSGCLSG
VKFNTLVPLKAIFHPTSPLRPYSIRGELVESSCASMLPLSTILIPPEMDPWYM
Download sequence
Identical sequences H0YX07
ENSTGUP00000002833 ENSTGUP00000002833 59729.ENSTGUP00000002833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]