SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002877 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002877
Domain Number 1 Region: 113-235
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000549
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 2 Region: 5-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000251
Family Growth factor receptor domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002877
Domain Number - Region: 679-762
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00738
Family Growth factor receptor domain 0.0057
Further Details:      
 
Domain Number - Region: 611-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0269
Family EGF-type module 0.071
Further Details:      
 
Domain Number - Region: 746-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0276
Family Laminin-type module 0.067
Further Details:      
 
Domain Number - Region: 869-914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family Laminin-type module 0.086
Further Details:      
 
Domain Number - Region: 826-856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0598
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 998-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Laminin-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002877   Gene: ENSTGUG00000002771   Transcript: ENSTGUT00000002906
Sequence length 1328
Comment pep:known_by_projection chromosome:taeGut3.2.4:21:2690615:2717229:1 gene:ENSTGUG00000002771 transcript:ENSTGUT00000002906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTLAQHRCQCRHNHQLHEDGKRCILRNPCSDRNGGCMHRCHSHRGRARCECHPGYQLAPD
GKACEDVNECLTGLAMCAHQCLNTRGSFKCTCNPGYELGADGKRCYRIEMEIVNSCETSN
GGCSHVCHHTSSGPVCTCNFGFRLEEDQKSCTDINECDTGSHCCQQDCYNYPGGYECSCH
AGYRLSTDGCGCDDVDECSANNGGCEHTCQNLPGSFQCGCDIGHKLDGDRRSCISIEDTV
EALDGRRPVIRPIPHVAILRDEFTQLFNDDYEEEEEELEARGEHTLSEKFVCLEHTFGPD
CSLTCDDCQNGADCGTEGSGCLCTAGWTGVLCNQTCPAGTFGTNCSQICQCQNGGTCDPA
TGACRCPPGVPGELCQDGCPKGFFGKHCRKKCNCANRGHCHRIYGACLCDPGLYGRFCHL
ACPKWVFGAGCSEECRCLQRNSRDCDARDGSCRCKPGYRGQRCQDSESPNPTSEQTPPCL
LNHEHRWEPLTAVGTPQGPRGSCSLQGQVECPEGTFGPGCQHPCACGEAPCDRSTGQCHC
PPGWTGHDCAQACPEGLWGPGCQQICPDCANNASCDPATGACLCPAGYTGQRCQDVCPPG
WFGPDCQLSCSCGNEGHCHPVTGTCSCPPGWTGHHCQRACDLGRWGPDCAHTCNCSNGDG
SCSAESGQCLCEPGYAGTRCEQECPEGWFGQSCRHQCQCDNGATCDHVSGACTCSPGWRG
TFCEHACPDGFYGLECRQACDCLNGAHCDPVTGQCQCPPGWTGARCAQACQENKYGQNCS
HTCLCFNNATCDHVSGRCLCSEGWTGPSCQQACPAGFFGKNCQQRCLCQNGGTCDPATGG
CACPAGWTGLACELACAQGQHGLDCQQRCECQHGGLCDRRTGRCLCQPGWTGDKCDTPCP
EGLFGARCEELCDCGDNISCHHITGACDCPHGWRGRRCEKACLPGFFGRSCASRCGCAPG
VPCHHVTGQCGCPPGLTGSACEKPCLPGTFGEGCAQICQCAGATQQCHPVTGACVCPPGF
HGPACQLECSPGWYGRDCERPCQCRNGGRCDPATGMCHCPPGFIGAHCSIRCPAGRYGQD
CAELCPCGAGVPCHPVTGECVCPAGRAGRRCEQGKCQHRYGLGCQQPCSCQNGGLCNTTD
GSCSCAPGWTGKSCELECPPGSFGAACQLRCPCLHNASCHPATGTCRCPAGRYGPLCEHS
CPPGFHGEGCRERCACGHGAGCDPATGHCHCPPGLRGERCHTGCKEGTYGEGCQHLCDCP
SDVPCDPVTGRCLCPPGKTGPTCAADCQPTHFGPDCRLACQCAPSSYCNARNGQCLCLDG
HTGPTCRE
Download sequence
Identical sequences H0YX51
59729.ENSTGUP00000002877 ENSTGUP00000002877 ENSTGUP00000002877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]