SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002888 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002888
Domain Number 1 Region: 170-486
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.51e-87
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000616
Further Details:      
 
Domain Number 2 Region: 1004-1272
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.07e-73
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000946
Further Details:      
 
Domain Number 3 Region: 488-691
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 3.56e-51
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.00087
Further Details:      
 
Domain Number 4 Region: 1275-1401
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.29e-31
Family Anticodon-binding domain of Class II aaRS 0.00011
Further Details:      
 
Domain Number 5 Region: 806-861
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 1.69e-17
Family a tRNA synthase domain 0.00019
Further Details:      
 
Domain Number 6 Region: 736-788
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 9.81e-17
Family a tRNA synthase domain 0.0000986
Further Details:      
 
Domain Number 7 Region: 36-147
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.13e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.022
Further Details:      
 
Domain Number 8 Region: 883-935
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000000000824
Family a tRNA synthase domain 0.00047
Further Details:      
 
Domain Number 9 Region: 1424-1495
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 0.00000000000053
Family C-terminal domain of ProRS 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002888   Gene: ENSTGUG00000002796   Transcript: ENSTGUT00000002917
Sequence length 1495
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:9683176:9718441:1 gene:ENSTGUG00000002796 transcript:ENSTGUT00000002917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GALLTVEHVKNDVEISVQEGKETILSVSEQVSFTDVNSIARYLARVAASAGLYGSNLLEH
TEIDHWLEFSATKLSTSSQFPSAIQELNHCLSLRTYLVGNSLSLADLCVWAVLKGNSMWQ
EQIEQNKAPVHAKRWFSFLEAQRAFQSVGAKWAAGTPKATEKEKKADVGKFVELPGAEMG
KVIVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTNPEKEKEDFEKVILEDV
AMLHIKPDQFTYTSDHFETIMKYAEKLIHEGKAYVDDTPAEQMKAEREQRVESKHRNNCV
NKNLQMWEEMKKGTEYGQTCCLRAKIDMSSNNGCMRDPTLYRCKNQPHPRTGSTYKVYPT
YDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYIWEYSRLNLNNTVLSKR
KLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGSSRSVVNMEWDKIWSFN
KKVIDPVAPRYTALLKDAVVPVNIPEAQEEMKEVAKHPKNADVGLKPVWYSSRVLIEGAD
AETLAEGEVVTFINWGNIIITKLNRNSSGKILSINAKLNLDNKDFKKTTKITWLAETPRA
PLIPTVCVNYEHLITKPVLGKDEDFKQYINRNSKQEELMLGDPCLKELKKGDIIQLQRRG
FFICDQPYEPVSPYSCKDAPCILIYIPDGHTKEMPTSGSKEKTKAETAKKEASSAVKGKS
APVVACTESSEGHLIVYNKVAAQGDVVRDLKAKKAAKEDIDKAVKQLLALKAEYKEKTGQ
DYKPGNPPVSGTAQSSKLGTSGTLDSKALYDKVAEQGEAVRKLKAEKASKDQIDEAVKLL
LSLKADYKEKTGQEYKPGHPPAAQGTVPQASNTAASGPDTPEAKALFSKVALQGDEVRKL
KAEKADKEKIDVAVKELLQLKAQYKSVAGVDYKPVSATGVDDKDKKKKEKENKSEKQSKQ
QKQNDGPKKEPLQGQSGNERSSDGSGEGQGPKKQTRLGLEAKKEENLSEWFSQVITKSEM
IEYYDVSGCYILRPWAHAIWEAIKDFFDAEIKKLGVENCYFPMFVSQAALETEKSHIADF
APEVAWVTRSGKTELAEPIAIRPTSETVMYPSYAKWVQSHRDLPIKLNQWCSVVRWEFKH
PQPFLRTREFLWQEGHTAFATYEEAAEEVLQILDLYARVYEDLLAIPVVKGRKTEKEKFA
GGDYTTTLEAFISASGRAIQGATSHHLGQNFSKMFEIVFEDPKKPGEKQFAYQNSWGITT
RTIGVMTMIHGDNMGLVLPPRVACIQVVIIPCGITNSLSEGDREALLKKCNEYRSRLLAV
NIRVRADLRDNYSPGWKFNHWELKGVPVRVEVGPRDMKSQQFVAVRRDTGQKLTLSEHEA
EEKLKQILEEIHANLYSRANSLQRLFFYMYNCWVFLSPLLFSFQIVQIPFCGEIECEDWI
KKTTARDQDLEPGAPSMGAKSLCIPFQPLRELQPGARCVCGKNPAKFYTLFGRSY
Download sequence
Identical sequences H0YX62
ENSTGUP00000002888 ENSTGUP00000002888 59729.ENSTGUP00000002888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]