SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002900 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002900
Domain Number 1 Region: 8-245
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.1e-78
Family Eukaryotic proteases 0.0000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002900   Gene: ENSTGUG00000002815   Transcript: ENSTGUT00000002929
Sequence length 245
Comment pep:novel chromosome:taeGut3.2.4:3:9782158:9783923:-1 gene:ENSTGUG00000002815 transcript:ENSTGUT00000002929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAYDYGMTRIVGGVGAAEAAWPWMVSIQHPWVPGLGHLCGGSLISSEWVLTAAHCFDKFN
NVSLFYVVIGATQFTQPGPGAAVRSVKQVLTHPYYSRIDFSYDIALMQLDHPVQCSSYIQ
RACVAEPTLTISDLTNCWVAGWGATAARSQGPPDRLQEAKVQLIDVQLCNSSDWYAGAIH
THNLCAGYPQGLIDTCQGDSGGPLMCQDNYADFWWVVGLTSFGKGCARAMRPGVYTSTQY
FFDWI
Download sequence
Identical sequences H0YX74
ENSTGUP00000002900 ENSTGUP00000002900 59729.ENSTGUP00000002900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]