SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002962 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002962
Domain Number 1 Region: 1568-1594,1621-1686,1766-1874,1917-1978,2135-2167
Classification Level Classification E-value
Superfamily Sialidases 0.000000000111
Family Sialidases (neuraminidases) 0.017
Further Details:      
 
Domain Number 2 Region: 2251-2318,2430-2505,2604-2629,2663-2713
Classification Level Classification E-value
Superfamily Sialidases 0.00000000118
Family Sialidases (neuraminidases) 0.035
Further Details:      
 
Domain Number 3 Region: 2469-2554,2662-2696,2747-3001
Classification Level Classification E-value
Superfamily Sialidases 0.00000165
Family Sialidases (neuraminidases) 0.027
Further Details:      
 
Domain Number 4 Region: 470-501,641-708,837-857,1027-1064,1157-1228
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000141
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.019
Further Details:      
 
Domain Number 5 Region: 678-709,837-904
Classification Level Classification E-value
Superfamily Sialidases 0.0000373
Family Sialidases (neuraminidases) 0.024
Further Details:      
 
Domain Number 6 Region: 1414-1455,1572-1627
Classification Level Classification E-value
Superfamily Sialidases 0.0000667
Family Sialidases (neuraminidases) 0.026
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002962
Domain Number - Region: 565-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000861
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 923-948
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00209
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 2373-2398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.028
Further Details:      
 
Domain Number - Region: 2021-2052
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00607
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 3124-3151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0398
Family Integrin beta EGF-like domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002962   Gene: ENSTGUG00000002836   Transcript: ENSTGUT00000002991
Sequence length 3351
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:12019634:12249614:-1 gene:ENSTGUG00000002836 transcript:ENSTGUT00000002991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIMSDHQFGNQFMCSVVASHVSHLPTTNLSFVWIAPPAGTGCVNFMATATHRGQVIFKDA
LAQQLCEQGAPTEAPLHPHLAEMHSDSIILRDDFDSYDQQELNPAMWSECSNCEVGGHCG
VIMHGNAATFCEPYGPRELTTTGLNTTTASVLQFSLGSGSCRFSYSDPSITVSYSKNSSA
DWTQLEKISAPSNISTIIHILYLPEDAKGENIHFQWKQDYVLAGDVYEACWALDNILIIN
AAHRKVVLEDNLDPVDTGNWLFFPGATVKHSCQSDGNSIYFHGTEGSEFNFATTRDVDLS
IEDAQEQWTEEFESQPKGWDIFGAVIGTECGTLESGSAMVFLRDGERKICTPYMDTTGYG
NLRFYFSMGGACDSGESHENDVILYAKIEGRREHIPLDTLTYSAYKVPSLVSVVISPDLQ
TPATKFCLKQKSHQGHNRNVWAVDYFHVLPVLPSSMTHMIQFSINLGCGTYQPGNSVSLE
FSTNHGRSWSLLHQECLPEICAGPHLPHSTIYASENYSGWNRITIPLPNAALTSDTRIRW
RQTGPILGNMWAIDNIYIGPSCLKFCSGRGQCTRNGCKCDPGFSGPACEMASQTFPMFIS
ESFASSRLSSYHSFYSIRGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSRFLQF
TLRLGSKSVLSTCKAPDQPGEGVLLHYSYDNGITWKLLEHYSYLNYHEPRIISVELPEDA
RQVGIQFRWWQPYHSSQGEDVWAIDEIIMTSVLFNSISLDFTNLVEVTQSLGFYLGNVQP
YCGHDWTLCFTGDSKLASSMRYVETQSMQIGASYMIQFNLVMGCGQAFTPHMDNQVKLEY
STNHGLTWHLVQEECLPSMPSCQEFTSASIYHSSEFTQWRRITVLLPQKTWSSATRFRWS
QCYYTAQDEWALDNMYIGQQCPNMCSGHGWCDHGVCRCDSGFRGTECQPENPLSSTIMSD
FENPDTLKTEWQEIIGGEIVKPEEGCGVISSGSSLYFNKAGKRQLVSWDLDTIWVDFVQF
YIQIGGETSSCNKPDSREEGVLLQYSNNGGINWQLLAEMYFSDFSKPRFVYLELPAAAKT
PCTRFRWWQPVFSGEGYDQWAIDDIIILSEKQKHIIPVVNPTLPQNFYEKPAFDYPMNQM
SVWLMLANEGMTKNESFCSATPSAMLFGKSDGDRFAVTRDLTLKPGYVLQFKLNIGCTSQ
YSSSAPVLLQYSHDAGLFWSLVKEGCYPASPGTKGCEGSSRELSEPSVYHTGDFEDWTRV
TIVIPRSLAASKTRFRWIQESSSHKSVPPFGLDGVYISEPCPNYCSGHGDCVSGVCFCDL
GYTASHGTCVSNVPNHSEMFDRFERKLSPLWYKITGGQVGTGCGVLSDGKSLYFNGPGKR
EAKTVPLDTTNIRLVQFYVQLGSKSVGSSCNRPRARNEGLVVQYTNDNGITWSLLRELDF
MSYLEPQVVSIDLPREAKTPATAFRWWQPQHGKHSAQWALDDVLIGMNDSSQTGFQDKFD
GTVDLQASWYRIQGGQVDIDCLSMDTALMFSENIGKPRYAETWDFHVSASTFLQFELSMG
CSKPYSNSHSVHLQYSLNNGRDWHLVTEECVPPTIGCQQYTESSIYTSERFQNWKRVTVY
LPPSTNSPRTRFRWIQYNYASGVDSWAIDNVVLATGCPWMCSGHGICDSGHCMCDRGFGG
PYCVPVLPLPSVLKDDFNGNLHPDLWPEVYGAERGNLNGDTIKSGTALIFKGEGLRMLVS
RDLDCTNTVYIQFSFKFIAKGTPERSHSILLQYSVNGGITWQLIDEFYFTQTTDVLFINV
PLPYAAQSNATRFRLWQPYNNGKKEEIWIIDDFIIDGNNLKNPIILLDTFDFGPKEDNWF
FYPGGNIGLYCPYSSKRAPEEDSAMVFVSNEVGEHSITTRDLSVNENTIIQFEINIGCTT
DSSSADPVKLEFSRDLGATWHLLLPLCYSSSSHLSSLCSTEHHPSSTYYAGTTQGWRREV
IHFGKLHLCGLARFRWYQGFYPAGSQPVTWAIDNVYIGPQCEEMCNGHGSCINGTKCICD
PGYSGPTCKISTKNSDFLKDDFEGQLESDRFLLVSGGKPSRKCGIMSGGNNLFFNEEGLR
MLMTRDLDLSQARFVQFFMRLGCGKGVPDPRSQPVLLQYSLNGGLTWSLLQEFLFSNSSN
VGRYIALEIPLKARSSSTRLRWWQPSENGHFYSPWVIDQILIGGNISGNTILEDDFTTLD
SRKWLLHPGGTKMPVCGSAGDALVFIEKASTRYVVTTDIVVNEDSFLQIDFAASCSVTDS
CYAIELEYSVDLGLTWHPILKDCLPTNVECNKYHLQRILISDTFNKWTRVTLPLPPYTRS
QATRFRWHQPAPFDKQQTWAIDNVYIGDGCIDMCSGHGKCTQDNCVCDEHWGGLYCDEPE
TPLPTQLKDNFNRSPSNQNWLTVNGGKLSTVCGAVASGMALHFSGGCSRMLVTVDLNLTS
AEFIQFYFMYGCLITPNNRNQGVLLEYSVNGGITWSLLMEIFYDQFSKPGFVNILLPYDA
KAIGTRFRWWQPKHDGLDQNDWAIDNVLISGSADQRTVMLDTFSSAPLPQHERAPADAGP
TGRIAFDMAVEDKTTVNEHWLFHDDCSIERFCDSPDGVMICGSHDGREVYAVTHDLTPTE
GWIMQFKVSVGCKPSEKVAQNQVHVQYSTDFGVSWSYLVPQCLPADPKCSGSVSQPSVFF
PTKGWKRVTYTLPESLVGNPVRFRFYQKYSDMQWAIDNFYLGPGCLENCRGHGDCLNEQC
ICDPGYSGPNCYLTQTLKTFLKERFDNEEIKPDLWMSLEGGNTCTECGILAEDTTLYFGG
ATVRQAVTQDLDLRGAKFLQYWGRIGSENNMTTCHRPTCRKEGVLLDYSIDGGKRISWTL
LHEMDYQKYISVRHDYILLPEHALTNTTRLRWWQPFTLSSGIVVPGPERAQWALDNILIG
GAEINPSQLVDTFDDEGTSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTHNILSS
RELIIQPGYMMQFKIVVGCEANSCGDLHSVMLEYTKDARTDSWQLVQTHCLPSSSNSIGC
SPFQFHEATIYNSVNSSMWRRITIQLPDHVSSSATQFRWIQKGEELEKQSWAIDHVYIGE
ACPKLCSGHGYCTTGAICICDEGFQGDDCSVFSHDLPSYIKDNFESERVTEINWETIQGG
VIGNGCGQLAPYAHGDSLYFNGCQVRQAVTKPLDLTRASKIMFVLQIGSISQTDSCNTNL
SDPNTVDKAVLLQYSVNNGITWQVIAQHQPKDFIQAQRVSYNVPLEARMKGVLLRWWQPR
HSGTGHDQWALDHVEVVLVHTRKQNYMMNFSRQHGLRHFFNRRRRSLRRYP
Download sequence
Identical sequences H0YXD6
59729.ENSTGUP00000002962 ENSTGUP00000002962 ENSTGUP00000002962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]