SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002967 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002967
Domain Number 1 Region: 113-178
Classification Level Classification E-value
Superfamily Chromo domain-like 1.39e-26
Family Chromo domain 0.0000236
Further Details:      
 
Domain Number 2 Region: 21-79
Classification Level Classification E-value
Superfamily Chromo domain-like 2.17e-21
Family Chromo domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002967   Gene: ENSTGUG00000002876   Transcript: ENSTGUT00000002996
Sequence length 184
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:52108427:52119316:1 gene:ENSTGUG00000002876 transcript:ENSTGUT00000002996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNKTTLHKMGKKQNGKGKKVEEAEPEEFVVEKVLDRRVVNGKVEYYLKWKGFTDADNT
WEPEENLDCPELIEAFLNSQKAGKEKTDGAKRKSLSDSESDDSKSKKKRDSVDKPRGFAR
GLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANVKCPQIVIAFYEERLTWHSCPE
DEAQ
Download sequence
Identical sequences A0A1D5PEX8 A0A1U7RVB3 A0A1V4KBV9 A0A2I0TLL5 G1NDX3 H0YXE1 U3IWW5
ENSAPLP00000011741 ENSMGAP00000011085 ENSTGUP00000002967 XP_002194254.1.42559 XP_005022142.1.99704 XP_005041031.1.66865 XP_005237245.1.75256 XP_005421802.1.5688 XP_005445874.1.10750 XP_005480935.1.73095 XP_005480936.1.73095 XP_005518947.1.90289 XP_006026551.1.24877 XP_006265415.1.47583 XP_008492442.1.100939 XP_008629544.1.15636 XP_008938571.1.37566 XP_009077852.1.14518 XP_009084311.1.15306 XP_009280308.1.47732 XP_009323996.1.49731 XP_009464772.1.38621 XP_009510939.1.22320 XP_009558941.1.62272 XP_009581007.1.87690 XP_009636951.1.23211 XP_009674728.1.43253 XP_009698169.1.71050 XP_009813212.1.37116 XP_009866602.1.31609 XP_009877832.1.48241 XP_009917838.1.2804 XP_009939648.1.35112 XP_009946710.1.99599 XP_009990482.1.11325 XP_010005869.1.85724 XP_010080239.1.40768 XP_010122643.1.88979 XP_010158142.1.22856 XP_010191312.1.17318 XP_010201445.1.23224 XP_010301915.1.13389 XP_010397315.1.2935 XP_010575887.1.12557 XP_010711094.1.16129 XP_011583827.1.59079 XP_013027337.1.65836 XP_013796830.1.3284 XP_014749803.1.99236 XP_014749804.1.99236 XP_014793143.1.91963 XP_014793144.1.91963 XP_015136770.1.86415 XP_015472920.1.82291 XP_019364163.1.87953 XP_019390512.1.79039 XP_021241115.1.32913 XP_021393885.1.53032 ENSTGUP00000002967 ENSGALP00000037037 ENSMGAP00000011085 59729.ENSTGUP00000002967 9031.ENSGALP00000037037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]