SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000002977 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000002977
Domain Number 1 Region: 4278-4452
Classification Level Classification E-value
Superfamily Fibronectin type III 5.89e-37
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 2 Region: 3875-4074
Classification Level Classification E-value
Superfamily Fibronectin type III 7.9e-35
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 3 Region: 2437-2628
Classification Level Classification E-value
Superfamily Fibronectin type III 9.43e-35
Family Fibronectin type III 0.00085
Further Details:      
 
Domain Number 4 Region: 3596-3780
Classification Level Classification E-value
Superfamily Fibronectin type III 1.08e-34
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 5 Region: 2144-2331
Classification Level Classification E-value
Superfamily Fibronectin type III 1.68e-34
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 6 Region: 4457-4640
Classification Level Classification E-value
Superfamily Fibronectin type III 2.66e-33
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 7 Region: 4746-4942
Classification Level Classification E-value
Superfamily Fibronectin type III 3.65e-32
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 8 Region: 2626-2803
Classification Level Classification E-value
Superfamily Fibronectin type III 1.91e-30
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 9 Region: 4087-4270
Classification Level Classification E-value
Superfamily Fibronectin type III 1.56e-29
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 10 Region: 1717-1899
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-29
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 11 Region: 1516-1690
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-28
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 12 Region: 1053-1242
Classification Level Classification E-value
Superfamily Fibronectin type III 1.63e-28
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 13 Region: 2824-3024
Classification Level Classification E-value
Superfamily Fibronectin type III 1.49e-27
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 14 Region: 2019-2140
Classification Level Classification E-value
Superfamily Fibronectin type III 3.54e-25
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 15 Region: 4599-4742
Classification Level Classification E-value
Superfamily Fibronectin type III 8.23e-25
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 16 Region: 1242-1287,1319-1405
Classification Level Classification E-value
Superfamily Fibronectin type III 9.4e-25
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 17 Region: 3457-3594
Classification Level Classification E-value
Superfamily Fibronectin type III 4.92e-24
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 18 Region: 1883-2058
Classification Level Classification E-value
Superfamily Fibronectin type III 2.1e-23
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 19 Region: 3028-3153
Classification Level Classification E-value
Superfamily Fibronectin type III 6.4e-23
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 20 Region: 116-292
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.72e-18
Family Laminin G-like module 0.053
Further Details:      
 
Domain Number 21 Region: 1394-1526
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000012
Family Fibronectin type III 0.0062
Further Details:      
 
Domain Number 22 Region: 2322-2445
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000116
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 23 Region: 3772-3876
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000108
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number 24 Region: 640-690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.004
Further Details:      
 
Domain Number 25 Region: 846-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 26 Region: 794-842
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 27 Region: 574-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 28 Region: 693-743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 29 Region: 746-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000809
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 30 Region: 899-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000145
Family Laminin-type module 0.0099
Further Details:      
 
Domain Number 31 Region: 1001-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000184
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 32 Region: 950-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000698
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000002977
Domain Number - Region: 517-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00121
Family Laminin-type module 0.069
Further Details:      
 
Domain Number - Region: 339-414
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0357
Family APC10-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000002977   Gene: ENSTGUG00000002871   Transcript: ENSTGUT00000003006
Sequence length 5215
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:11359869:11752027:1 gene:ENSTGUG00000002871 transcript:ENSTGUT00000003006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRALSLRCRFLFHAIETLILTYYDSFVLVSSQGHFPRLENVGAFKNVSIVPTQATCGLPD
RSTFCHSSVAIESIISCTQKFCVQECPYRSSPSSYKLLLSEGLGTCITEDKRDLHPGSSS
NASSFIFHNHKDCFSTPRLPRLGASFTLTVWLKPEQEGVMCVIEKAIDGKTVFKLTISEK
ETMFYYRTVNGLQPPIKVMTLGRILVKKWIHLSVQVHHTRISFFLNGWEDDNTAFDSRTL
MGTVADADADGTLQIGQSFTGLEQFVGRMQDFRFYSVALTNRDILEVFSGKFPHLHTQSE
CRCPGSHPRVHPLIQRYCIPNGADDTTNDRVLRLDAEAHPLHYINDNDIGTTWISSAFAN
TAGLDRGVSITIDLQNGQYQVFYIILQFFSPHPEAIKIERKKRDDLEWEDWQYFARNCSI
FEMENNGSLEKPDSVNCLQMHSFTPYSRGNLTFSVLTPEPNHRPGYNDFYNTPSLQEFVK
ATQVRIHLRGQYHTNEPWVNFRHRYYGVYEVTVSGRCNCHGHADACDTAMKPYRCLCVEE
SYTEGIQCDRCLPLYNDKPFRPGDQVHAYNCKPCQCYGHAESCHYDLAMDPFPQEHHRGG
GGVCDNCQHNTAGRNCELCKDFHYRQAGADLSAIDVCKACNCNATGTENKSLLCDSIGGQ
CNCKRHVSGRQCNQCQEGFYNLQQSNPDGCSPCNCNTSGTVNGDITCHQNSGQCKCKANV
IGLRCDSCNFGFKALRYSNEDGCEPCWCNSHGSVNQFCNPLSGQCNCKERVKGLLCDTCM
DNFYGLDVTGCKACECDAAGSISGTVCDARTGQCACKPNIGGRRCDECLDGYHRVQKGHA
FLCLPCNCEKAGTVNGSLLCDKSTGQCPCKAGVTGLRCSQCMLQTYNLSMSNARGCQPCH
CDAQGTLAGTACDHASGQCVCLPQRQGRRCDECKPGFYFSPSSITGCLPCLCHIAGSVNQ
ICDKLTGQCSCQDASVTGQTCERCKELYFGFDSVTGRCQHCNCHPAGAINGTCHLVTGQC
VCKQFVTGLKCDNCVQDASNLDVHNLFGCSKTPFQQPPPTGEVLNSSVINLSWSSPDSPN
SNRLIYQLYRDEEEIYTTEDYHPYSVQTFTDTMLAPYTFYSYFIQASNVHGFTRSDSVTY
RTKSGTPVGSLDLNPVFPVSHHSVLLYWTSVSNESGPIEKYILTCTSTVDLQPCGQYEGL
KTSAIIWNLIPFTKYVFSVQACTSGGCLKSQPVAVVTAQAPPEGLHPPTVETISSTELAV
EWSPPEKPNGIIIRYELYMRKKLKSAGNFLPPEIRIFQSSGWLSPQPVVESQNENALAPP
QTSTTVIDLEPFTEYEFYVLAVNMAGSISSDWISGRTGEAAPVFMPSPLVFPLSPHSLNV
SWEKPEDNISRGEVMGYSISLMTEQRSLPPFSQFALQVLHIAEAHELSYIATGLKPYRTY
NFTVTLCNQIGCVTSEPGMGQTLAAAPRKLSTPRVEGINSTTVKIIWNEPEELNGPSPIY
QVERMDSSLATMNIEVTKGIRFPGNGYYRFASSTLPTNTYFTGIKVKFRTQEPDGLIFFS
ASPGNQEEYIALQLKSGRPYFLFDPQKKGSAVAVTPTNDGGKVYNDNSWHQVIATRTQAL
GNITVDGQYTGSSLATSGSTIIGENTGVFVGGLPQGYTIVRKDEGMKRIVQKGICGCLSD
IFLKKVHTPYENWNFNWENAAEQNNVYQVWEGCPIGLSKGAHFLGRGFLELHSGVFSGGL
EFEISFKFRTDQLNGLLLFVYNKDGPDYLAIELKSGILNIFLRTGIVFTQVDLWLGLSYC
DGKWNEVTMSKEGSVISATMNELREQALEPRVQQLQVNSPVYVGGIPPEIQGFYRELGLE
QGFGGCMKDVKFTRGAVVNLASVSSSAVRVNLDGCLSTDSAVNCRGNDSILVYRGKEQSV
YESALQPFTEYLYRVVALNEGGSVSSAWTHTRTRESVPQNVPTPSRAHSINGYSIEVTWD
KPAGVIGVIEKYILKAYEADGPTVPITSAELADAGMLTGVLRGLHPFTNYAVTLTACTLA
GCTESLHALNISTPQEAPEDVQAPTAISFPTFLLMSWSPPKTPNGIITQYTLYMNGIPIY
SGNGTKYVVKDLAVFTPYHFLLTACTLAGCTNSSQVTLFTAQLPPSHVDAPVLTVLDSRT
IYVQWKEPVEVNGILDHYIIYMATNEQNFTKWNVIYNSTELFLDFTIPQLFPGTEYLIKL
AACTGGGCSISEASTAVTDESTPEGVPAPKAQSYSSDSFNISWTKPEYPNGIITSYGLYM
DGVLLQNSSQLSCYAYGLAPWSLHSFRVQACTAKGCALGPLVEARTMEAAPEGMVDVFTT
VDGSKEVQLKWLAPNRPNGKLTYTVLVTGLFYADQDNANYSIVNDTRMMCSSKEFNVWVP
IKGLIPFSNYTVQVNASNSQGSLISDAITIVMPPGAPDGVMPPRLSSATPTSLQVVWSTP
VRNNAPGTPSYRLQMRRRRSAGDILDLHPSPTASLQHRVGDLQPYTEYEMRVVASNGYGN
AYSNWTSMTTAEDIAEPGPLDPPLLLDVTARAASITWQHPLQPNGIITHYNIYQNGQLHA
TVPGTTSNCTVEDLHPYTVYVFQVEGCTSKGCSLSPTTPEIQTLPDAPEDIPAPELYSDT
PTSVVISWQPPARPNGLVENLTIERRVKGTEQISTVARLPFGQTMSYIDQSTALSPWQKF
EYRVLMSTLHGSSNSSAWAEVTTRPSRPAGVQPPDAEALGPYSVKVSWKPPLIPNGEILN
YEIRMPDPRIVIAGNPSSRLSHLVTNLVPYTNYSVTVIACTGGDGFLGGCTESLPTRVTT
PSTIPQSVSPLSVTPISESFIAISWQPPLRPNGPHLRYELLRRKIQQPLASNPPEDLNLW
HNIYSGTQWFYEDKGLSRYTTYEYKLVVHNEVGYTSSEEVRATTLAGLPEKGSVLVARAV
NHTAVEVEWSKPTLQDLQGDVVYYTLFLNSTDERRSLRVQADVNSVVIDDLQPNTEYQIF
SQVFNGVHSINSEVVHVTTSDGEPEGMFPPEVVIINSTAVRVIWTSPSNPNGVVTGYSVY
VNNQQYKTGMSEPGSFLLADLSPFTVYDIQIEACTVYACVRSNGSQITTVEDEPKQLSAP
IIHIIGSRSLQINWASPGQPNGIILGYELLRKAWQKCTSLKTPRSSRSNRMCISLECKKN
ENICGEVCYRPELEVCCNGILHNNKPGFQCCEDKYIPFILNSPGVCCGGQIHAVQPKHQC
CGGYYTRILVGEVCCPNEEENRVSVGIGDSCCQGMPYSTSNQICCGGTLHDSFNQQCCGG
RVISMDSVCCGDEKEGTAYRPLTGMFCCGQEYVNKSDTICCTGSSGESLAHVRKNDQVPV
KCCETELIPKSEECCNGVGYNSLKYVCSDRISAGMMMKVKEECKANVLCPLSMEETAHCG
KCDFDPKENICAWIKGSQSATETEVEAGVCLAEEETVYTGGPTQYSFTDVNLEPFVTYEY
RVAAWNSYGRGFSEISRAVTKQDVPQGVSPPKWAKVDNREDMILLDWEEPLQPNAIGLII
HYIILRNGIEHFRGTETSFTDTSGVQPYHEYSYQLRACTVAGCTDSSKVVAVTVQGVPES
VQPPEVSALNSTALHLSWGAPKKPNGIIREYQISQVGRGLIYTDAAGRMQHTVSGLQPYT
NYSFVLIACTSAGCASSQPLSGQTLQAAPHGVWPKPHHIIVSSTEVEMYWSEPEEPNGLI
THYRLFRDGEQIFLGGSTARNFTDVNLQPNSRYVYQLEASTWGGSNTSDKYVIQTPAGTP
EKIHVPYNVTVIDAYSIFLAWDVPGIFIVNVPLEYNILLNASSPTLLVKPVGRAHFAFVD
GLDPYTLYEIRIQACQNGGCGVGGQTYARTAEAPPRELSPPVVKAIGPALIEVKWAPPRK
PNGIITNYFIYRRPVGSQEELLLFIWTGGPLEFIDASDALQPFTLYEYRARSQNSVGSVD
SLWASTQTLEAPPWGMGAPWAQATGAYSVRLNWSQPESPNGVISLYRVVYQEKRSDPTFS
TPAVTALTVMGTKHQAHLFGLKPFTTYHIHVVAVNNAGQVSSPWTSVRTLEASPSGLSNF
TVEKKENGRALLLKWSEPSQPNGIIKTYNVFSDDHLEYSGLSRQFLFRRLEPYTLYTLVL
EACNSAGCTRSPPQPVWTDEAPPVSQMAPVIQAVNATNVQLSWLQPINPNGKIIRYEVIH
RHREKTVAGHGATTEDEKIIFTEYNTESNTFTYNDKNLQPWTRYEYKIRTWNAAGYADSS
WTVAETSQTAPKGLAAPSLSVLSANPHKVFISWTPPAQPNGILQSYRLLKNDALYPFSFD
AATLSYIDEDLLPYTVYSYAVVACTMGGCSTSEPAAIRTLEAAPALVDPPSLQAVSATQI
SASWAPPQIQNGDITKYILKLGNEEYYPGNSFQMLVSNLKPYTQYDFALVACTAGGCTSS
TSQSVMTMEAPPLNMEAPRLLVMGSESIEITWKLPDKPNGKITSYDLRRDGVLVYSGLET
RYLDFTLMPGMEYSYTVTANNSQGSVTSPSAQIRTNPSAPSGMLPPRLQAWSSSEILVAW
DPPIKVNGDIRNYTISLHKPGETGKKTFDFDASHVSFLRRSYIVAQLQPYSRYEVQLQAC
TELGCASSEWASAWTLEAPPAAQPAPLIEIQTAGGFQSTASILWTGPKQPNGKILYYELY
RRRTTQAHINLDLSLVYNGSSTSFKDDKLLPYTEYEYQVWSVNSVGRTPSSWSRCRTGPA
PPEGLGAPLFNTVASTVAVVSISPPLKPNGVVSIYRLFSNGTRGTDVVLSEGTATQQTIH
GLKPFTTYSIGVEACTCFNCCSKGPMAEFTTQPAPPSEQPPPQIRTVTSRNASFQWSAPQ
SPNGIVTSYELHVYMACPLNLQPAVKACSPGPTEVKYTGKGQSANVSNLEPYTTYNLRVV
SYNSVGSSASEWIGFTTEKEPPRYMAPFSVVSNLSVIHIDWSHTFVLNGRLKEYALTESG
RRIYSGFDTELYLPRTSDKTFLFQVTCITDEGSAMTPVIKYNAGEGVGLILTTPGEKDKA
ESKRAKFYNELWFAVLMVVLGLILLAILLSLILQRKVHKQPYARDRPPLVPLQKRTSPMS
VYSSGETHPGLSDTKIPGAGSPTSNHSFRMAAGGRRQSQGQLSRTYSPASLHRSVSQLLN
LYDKKTFDESPWDAILHNHRTIPSLQYVDEEDLVNVIKGFSTVTKEHTTFTDTHL
Download sequence
Identical sequences H0YXF1
ENSTGUP00000002977 59729.ENSTGUP00000002977 ENSTGUP00000002977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]