SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003029 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000003029
Domain Number - Region: 76-168
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.000541
Family Gonadodropin/Follitropin 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003029   Gene: ENSTGUG00000002945   Transcript: ENSTGUT00000003058
Sequence length 212
Comment pep:known_by_projection chromosome:taeGut3.2.4:27:2898937:2903416:-1 gene:ENSTGUG00000002945 transcript:ENSTGUT00000003058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIPWAVCAVCVLTQITSHSVQGWQMFKNDATEIIPEITENTETPVEPTFSNNNTMNQAK
HGGRHIQQAPDLNDAAFSCREVRTTRFLTDGPCRSLKPVKELLCSGQCEPSHLLPNSIGR
GKWWRQGALDFRCIPAHSRTQRVPMACPQQETRTYKFRAATSCKCKRYTRYHNQSELKDF
GKESARPQKNKKPHLGRARSGKSNQPELENAY
Download sequence
Identical sequences H0YXK3
XP_002198562.1.42559 ENSTGUP00000003029 59729.ENSTGUP00000003029 ENSTGUP00000003029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]