SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003034 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003034
Domain Number 1 Region: 878-1180
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.5e-92
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000833
Further Details:      
 
Domain Number 2 Region: 213-356
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-33
Family Third domain of FERM 0.0034
Further Details:      
 
Domain Number 3 Region: 105-212
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-28
Family Second domain of FERM 0.00053
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-20
Family First domain of FERM 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003034   Gene: ENSTGUG00000002916   Transcript: ENSTGUT00000003063
Sequence length 1184
Comment pep:novel chromosome:taeGut3.2.4:3:12162668:12229282:1 gene:ENSTGUG00000002916 transcript:ENSTGUT00000003063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVVSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKNQQDRWVELEKPLKKQLDKFANEPLLFFGVMFYVPSVSRLQQEVTRYQYYL
QVKKDVLDGRLISSFEQGIRLAGLAVQADFGDYNQFESHDFLREYVLFPMDWTQDEAVLE
DLTQKVAQEHRNHSGITAAEAELMYINEVERLDGFGQEIFPVKDNHGNDIHLGIFFMGIF
IKNRIGRTTVIYRWNDIGNIAHNKSSIVLELINKEENVLFHTDDLENAKYISRLFASRHK
FYKQNKICTEQSNSPPPIRRRPTWSRSSLPRQHPFILPPMHVQCGEHYTETHNSQDSIFH
GNEETFYCRSQTSLDSYLNGNGPNGSVCSAHSMNSLNRSQNFVQASPMSSNLSIPGSDIM
RADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGVIQMDSQSQSLRNLNIGNTHAYNQPE
DLVYSQPEIRERHPYTIYGPQGGGYNKPVAPSDQMNPNNAAQNKTAASAISHTVSTPELA
NMQLQSSQSYNTTHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTRKVQ
LSVKTFQEDSSPVVRQSLQEVSEPLMAVKHHAAVNKRHSLEVISNMVRGIEAMALKTLNA
PLPRRNTLREQVQPEESVQMGHEVQQVPHYHHKKTFSDATMLIHSSESEEEEETQESVSR
IAALHENMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDHVSISVAVARAKAMRP
GPSKAISVSRTDQVAINGSSLGPSISEPDLTSVKERVKKEPVKERPVSEMFSIEDSIIER
EIMMRNLEKQKMAGLEAQKRPLMLAALNGLSVARVPVPEDSQDEVTKVPMDERCKILRRK
LEEGMVFTEYEQIPKKKADGIFTTAALPENTERNRVREVVPYEENRVELVPTKENNTGYI
NASHIKVTVGGEEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRSKSHRYW
PKLGSKHSSATYGKFKVTTKFRTDSGCFATTGLKVKHLLSGQERTVWHLQYTDWPDHGCP
EEVQGFLSYLEEIQSVRRHTNSVLDSSNTCNPPIVVHCSAGVGRTGVVILTELMICCLEH
NEKMDVPVMLRHLREQRVFMIQTIAQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences H0YXK8
ENSTGUP00000003034 ENSTGUP00000003034 59729.ENSTGUP00000003034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]