SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003043 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003043
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000372
Family Ubiquitin-related 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003043   Gene: ENSTGUG00000002958   Transcript: ENSTGUT00000003072
Sequence length 457
Comment pep:known_by_projection chromosome:taeGut3.2.4:18:1020952:1069804:1 gene:ENSTGUG00000002958 transcript:ENSTGUT00000003072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIRVQSPEGVKRITATKRETVGTFLKKVAKEFGFRNNGFSVYTNRNRTGEITAAQNKSLN
LLKIKHGDMLFLYPSSPAGSSSETMDTSVSQNSRPGGAPQVVEDEIDQYLIKQDGKIYRN
RDQQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALE
NISCKIKSGCEGHPPWPEGICTKCQPSAITLNRQKYRHVDNIMFENHTIADRFLDFWRKT
GNQHLGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLEILEDPKAEVVDEIAAKLG
LRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSAEECITAGNFQNQQPNICRLSPDGHFG
SKFVTVVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCRDAPELGYAKESSSEQYVPDV
FYKDIDKFGNEITQLARPLPVEYLIIDVNLALSPVSP
Download sequence
Identical sequences H0YXL7
ENSTGUP00000003043 59729.ENSTGUP00000003043 ENSTGUP00000003043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]