SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003046 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003046
Domain Number 1 Region: 83-190
Classification Level Classification E-value
Superfamily Immunoglobulin 6.61e-17
Family I set domains 0.022
Further Details:      
 
Domain Number 2 Region: 33-79
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000277
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003046   Gene: ENSTGUG00000002954   Transcript: ENSTGUT00000003075
Sequence length 205
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:16249844:16264856:-1 gene:ENSTGUG00000002954 transcript:ENSTGUT00000003075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGRCAPGLECVKSRQRRKAKGGPVPPAAGPPGVCLCKSRYPVCGSDGLTYGSGCQLRAAS
LRAQSRGEPAISQRSKGACEQGPSIVTPPKDIWNVTGAQIYLSCEVIGIPTPVLIWNKII
RGQYGVQRMELLPGDRENLAIQTRGGPEKHEVTGWVLISPLSKEDAGEYECHASNAKGEA
TASAKIHVVETLHEIALNKDDGAEL
Download sequence
Identical sequences H0YXM0
59729.ENSTGUP00000003046 ENSTGUP00000003046 ENSTGUP00000003046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]