SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003076 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003076
Domain Number 1 Region: 1-241
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.71e-80
Family Eukaryotic proteases 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003076   Gene: ENSTGUG00000002976   Transcript: ENSTGUT00000003105
Sequence length 242
Comment pep:novel chromosome:taeGut3.2.4:27:2954400:2956501:-1 gene:ENSTGUG00000002976 transcript:ENSTGUT00000003105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIVTGTGALPGAWPWIVSIQDPRKTGTGHTCGGSLISPQWVLTAAHCFLQARNVTMWRVL
IGATKLTHLGPETQVRHIKRLLAHQEYMADSQQNDIALLELDEPVECSDYVQLACVPNAS
LTVSELKTCYIAGWGSASAKAQGPSDVLQEAKVRLLDIRLVNSSHRYAGAIHTHNLCAGY
PRGGMDTCQGDSGGPLVCKDNRASYFWLVGVTSWGKGCARTKRPGVYTSTQYFYNWILIQ
MG
Download sequence
Identical sequences H0YXQ0
ENSTGUP00000003076 59729.ENSTGUP00000003076 ENSTGUP00000003076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]