SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003118 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003118
Domain Number 1 Region: 185-328
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-41
Family Third domain of FERM 0.00049
Further Details:      
 
Domain Number 2 Region: 78-187
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-28
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 3 Region: 3-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-22
Family First domain of FERM 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003118   Gene: ENSTGUG00000003017   Transcript: ENSTGUT00000003147
Sequence length 351
Comment pep:known_by_projection chromosome:taeGut3.2.4:4A:7895974:7905795:1 gene:ENSTGUG00000003017 transcript:ENSTGUT00000003147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLKVQFLDDSQKIFVVDQKSCGKGLFNLTCSHLNLVEKEYFGLEFHSQAGNQVWLEPL
KPITKQVKNPKEVLFKFMVKFFPVDPGHLREELTRYLFTLQIKKDLAQGRLPCSDKSAAL
LVSHLLQSELGDFHEETDQQHLATHRYLPNQEYLDNKILRYHRRHRGKSPAESDVQLLDV
ARKLEMYGIRPHPASDGEGTQINLAVTHMGVLVLRGNTKINTFNWSKIRKLSFKRKHFLI
KLHANISALCKDTLEFTMASRDTCKAFWKTCVEYHAFFRLSEEPKSKPKALLCSKGSSFR
YSGRTQRQLLELGRKAKMKSLPFERKHYTSRYDERQCRSSPDLLTDVSKQV
Download sequence
Identical sequences H0YXU2
ENSTGUP00000003118 ENSTGUP00000003118 59729.ENSTGUP00000003118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]