SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003158 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003158
Domain Number 1 Region: 731-1092
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.45e-104
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000000053
Further Details:      
 
Domain Number 2 Region: 529-728
Classification Level Classification E-value
Superfamily ARM repeat 2.76e-62
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00000000848
Further Details:      
 
Domain Number 3 Region: 351-527
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.53e-53
Family PLC-like (P variant) 0.000000206
Further Details:      
 
Domain Number 4 Region: 146-321
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-52
Family Ras-binding domain, RBD 0.000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003158   Gene: ENSTGUG00000003053   Transcript: ENSTGUT00000003188
Sequence length 1106
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:13481190:13506115:1 gene:ENSTGUG00000003053 transcript:ENSTGUT00000003188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGDHEQPVVMRDENKRRRRRMKPHCASSSFSSMELISIEFILPTSNKHTKAPETMLLE
IAGNCTVEQMKAQIWMRAIETSQTTDFYHAFTPDQFILQYQKKGQWYEIYDKHQVLQTLD
CILYWKVLQKKVGKIYVVQKQTPSEEVQELQRQLNDLIGYDVTDVSNVHDDELEFTRRRL
VTPRMIEVACRDPKLYAMHPWTTSKPLPEYLFKKIINNNIFIIIHRGTTSQKIKVSIDDT
PDMILHSFFTKMAKKKSLMDIPEDHSELDFVLRICGRDEYITGDTPIKDFHWIRQCLKNG
EEIHLVLDNPPDPNEDEVQKEEWPLVDDCTGVTGYHEQLTIDGKDHERVFTISLWDCNRK
FRVKIIGIDIPVLPRNTDLTVFVEANIQHGQQLLSQRRTSSKPFTEEVLWNIWLEFDIKI
KDLPKGALLNLQIYCGKAQGPSAKTNLQSHESSNSDAKCKTQLLYYVNLLLIDHRFLLRS
GEYVLHMWKIPGKGEEQGSINADKLTSATNPDKENSMAISIVLDKYCHPIALPKHRISSD
PQGDRTRAEMPNQLRKQLEEIIATDPLNPLSPEDKELLWHFRYESIKHPKAYPKLLSSVK
WGQQEIVAKTYQLLAKKEAWDQSTLDVGLTMQLLDCNFSDENVRAMAVQKLESLDDDDVL
HYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSMHYQQRFAVIL
EAYLRGCGKAMLHDFMKQVQVIELLHKVTMEIKSVSAEKYDVTSQVIAQLRQKLEKLQGS
KLPESFRVPYDPGLRAGALVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDD
LRQDMLILQILRIMESIWEAESLDLCLLPYGCISTGNKIGMIEIVKDATTIAKIQQSTVG
NTGAFKDEILNQWLKERCMIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITET
GNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLYVMGTSGKKTSLHFHKFQDVCVKAY
LALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKHFLDQIEVCRD
KGWTVQFNWFLHLVLGIKQGVEKHSA
Download sequence
Identical sequences H0YXY2
59729.ENSTGUP00000003158 ENSTGUP00000003158 ENSTGUP00000003158 XP_002192548.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]