SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003232 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003232
Domain Number 1 Region: 482-563,604-760
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.22e-60
Family Tandem AAA-ATPase domain 0.0001
Further Details:      
 
Domain Number 2 Region: 246-480
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.32e-55
Family Tandem AAA-ATPase domain 0.0000992
Further Details:      
 
Domain Number 3 Region: 2-50
Classification Level Classification E-value
Superfamily UBA-like 0.00000323
Family CUE domain 0.025
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003232
Domain Number - Region: 151-187
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0006
Family ComEA-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003232   Gene: ENSTGUG00000003127   Transcript: ENSTGUT00000003264
Sequence length 784
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:18442134:18463341:1 gene:ENSTGUG00000003127 transcript:ENSTGUT00000003264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WERQEMLVKKLQSTFPGLDKEELREVLEEHNWVFHDALEALKIFADDEEGLELCNQSVNP
TTLNVAGSKPIADWTEASTKTPSEEKASEREQNGFRKGQVKRSILSAERETDHVEDESSS
EDGGSSLDEDYSSGDEVMEDSYKAKILSFLQDASLSELTLIPQCSQKKAQKIIALRPFNS
WEALFTKMTKTSGLSEDIVWNCKILLKEREVVLKLMNKCEDISNKLTKQVTRITRDGECG
WNIEQPSILNRSLKLKPYQKIGLNWLALLYKHRLNGILADEMGLGKTIQAIAFLAYLYQE
GNKGPHLIVVPASTLDNWIREVHLWCPELNVLFYYGSQEDRKHLRLDIHNKVVDFNVIVT
TYNSAMSSSDDRGLFRRLKLNYAIFDEGHMLKNMSSIRYQHLMTINAKNRLLLTGTPVQN
NLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSAEEQSIYEKERIAHAKQIIKPFILRR
VKDEVLKQLPPKKDLIELCAMSEKQEQLYLALLNKLKKSINSNENNSNMGNAMMQLRKMA
NHPLLHRQYYTNDKLRTMSTLMLKEPTHCDANPDLIFEDMTVMTDFELHVLCKQYSHIND
FMLDMDQILDSGKFRALERILSNLKEKGDRVVLFSQFTMMLDILEVLLKHWQHRYLRLDG
KTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANIVILHDIDCNPYNDKQAEDR
CHRVGQTREVQVIKLISKGTIEETMLKISQQKLKLEQDMTAAESGEEGSIPADIATLLKA
SLGL
Download sequence
Identical sequences H0YY55
ENSTGUP00000003232 59729.ENSTGUP00000003232 ENSTGUP00000003232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]