SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003250 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003250
Domain Number 1 Region: 2-43
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000259
Family Chromo domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003250   Gene: ENSTGUG00000003156   Transcript: ENSTGUT00000003282
Sequence length 333
Comment pep:known_by_projection chromosome:taeGut3.2.4:18:1463425:1465062:1 gene:ENSTGUG00000003156 transcript:ENSTGUT00000003282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPKKRGPKPKTFLLK
AQAKAKAKTYEFRSDSSRGIRVPYPGRSPQELGSTSRAREGLRNLALAPQGSSSSSTPKA
DGIRDRVIRVEEKPGETPKKRGPKPRKELYKDLAETLDASKRKLGDPGDKVGDYLKARKM
EGRRGGAAKFLGNTLIHQHHRQEPDLPGALPGPNRAEAGAETFPPRLAKHRADFLDPKGQ
GGLDPGGPKLLHGAVSPGAVGSLYRDGVGGPAGRPSLIARIPVSRILGDPEEESWSPSLN
NLEKVVVTDVTSNFLTVTIKESSTDQGFFKEKR
Download sequence
Identical sequences H0YY73
ENSTGUP00000003250 59729.ENSTGUP00000003250 ENSTGUP00000003250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]