SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003266 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003266
Domain Number 1 Region: 353-485
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.61e-34
Family DEP domain 0.0000091
Further Details:      
 
Domain Number 2 Region: 179-290
Classification Level Classification E-value
Superfamily PDZ domain-like 2.13e-23
Family PDZ domain 0.0000309
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003266
Domain Number - Region: 1-25
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00227
Family DIX domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003266   Gene: ENSTGUG00000003140   Transcript: ENSTGUT00000003298
Sequence length 640
Comment pep:novel chromosome:taeGut3.2.4:21:4281896:4316411:1 gene:ENSTGUG00000003140 transcript:ENSTGUT00000003298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVKEEISDDNAKLPCFNGRVVSWLVLAESSHSDTGSQCTESHAELPPALERTGGIGDSRP
PSFHPNAASSRDGLDNETGTESVVSHRRERHRRRNREGHEDGEINGHPKLERHREHPPGY
DSSSTVLSSELESSSFIDSEDEEHTSRLSSSTEQSTSSRLIRKHKRRRRKQRMRQIDRSS
SFSSITDSTMSLNIITVTLNMEKYNFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRI
EPGDMLLQVNDVNFENMSNDDAVRVLREIVSKPGPISLTVAKCWDPTPRSYFTIPRAEPV
RPIDPAAWISHTTAMTGAYPRYGMSPSMSITTSTSSSLTSSIPESEKLEESPLTVKSDMA
TIVKVMQLPDSGLEIRDRMWLKITISNAVIGADVVDWLYTHVEGFKDRREARKYASSMLK
HGYLRHTVNKITFSEQCYYVFGDLCGNLAALNLNNGSSGASDQDTLAPLPHPAAPWPLGQ
GYPYQYPLPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSNRSTSETSRRGAGREKER
KSGGSGSESEPGARRERPLSQLSQRSASDRSHQSHHSYGPPGLPPLYSLPKLGSKGLGSS
GPPGAPPVRELSAVPPELTGSRQSFQKAMGNPCEFFVDIM
Download sequence
Identical sequences H0YY89
ENSTGUP00000003266 ENSTGUP00000003266 59729.ENSTGUP00000003266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]