SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003271 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003271
Domain Number 1 Region: 125-372
Classification Level Classification E-value
Superfamily vWA-like 2.67e-85
Family Integrin A (or I) domain 0.00000000119
Further Details:      
 
Domain Number 2 Region: 368-457
Classification Level Classification E-value
Superfamily Integrin domains 1.78e-30
Family Integrin domains 0.00000759
Further Details:      
 
Domain Number 3 Region: 624-708
Classification Level Classification E-value
Superfamily Integrin beta tail domain 8.37e-26
Family Integrin beta tail domain 0.0000112
Further Details:      
 
Domain Number 4 Region: 22-76
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000575
Family Plexin repeat 0.00018
Further Details:      
 
Domain Number 5 Region: 582-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family Integrin beta EGF-like domains 0.00074
Further Details:      
 
Domain Number 6 Region: 540-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family Integrin beta EGF-like domains 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003271
Domain Number - Region: 507-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0229
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003271   Gene: ENSTGUG00000003122   Transcript: ENSTGUT00000003303
Sequence length 781
Comment pep:novel chromosome:taeGut3.2.4:27:3437094:3456889:-1 gene:ENSTGUG00000003122 transcript:ENSTGUT00000003303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQLSVTLGILLLCAAGSWGGNICSTRGVNSCKQCLAVSPLCAWCSAEVWAHSAPRCDLH
ANLLHNGCGQDHIEFPSSSVTILEDRPLSNKGSGGSTTTQMSPQRIQLNLRPDDSQVFHV
QVRQVEDYPVDIYYLMDLSNSMKDDLRNIQNLGTKLASEMRKLTSNLRIGFGAFVDKPIS
PYMYISPPEAIKNPCYEIGETCLPMFGYKHVLSLTDEVTRFNEEVRKQSVSRNRDAPEGG
FDAIIQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDAQCHIDKDNFYS
ATTTLDYPSLGLMTEKLSQKNINLIFAVTDTVVGLYQNYSELIPGTTVGTLSRDSSNVLQ
LIVDSYGKIRSKVELEVRDLPEELSLTFNATCLNDEVILGLKSCMGLKIGDTVSFSIEAK
VRGCPQEQQKSFTIKPVGFKDSLTVVVNFDCECSCESHAEANSPSCSHGNGTLECGVCRC
HPGRLGSHCECSEEEYNPSQQDNCSPRPGQPLCSQRGECICGQCVCHSSDFGKVTGKYCE
CDDFSCVRFKGQMCSGHGQCSCGDCLCNSDWTGDYCNCTTRTDTCMSSNGLVCSGHGSCV
CGRCECTQPGSYGDTCEKCPTCPDACTIKKDCVECKKFERGKLMDQQSCSRMCRDEIETV
QELSDGGKNAVNCTYKDENDCVMRFQYYEDSSGKSILYVIEEPDCPKGPDILVVLLSVTG
AILLIGLAALLIWKLLITIHDRREFAHFEEEKARAKWDTTHNPLYKEATSTFTNITYRGN
M
Download sequence
Identical sequences H0YY94
XP_002198873.1.42559 ENSTGUP00000003271 ENSTGUP00000003271 59729.ENSTGUP00000003271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]