SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003307 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003307
Domain Number 1 Region: 208-352
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-36
Family Third domain of FERM 0.003
Further Details:      
 
Domain Number 2 Region: 105-210
Classification Level Classification E-value
Superfamily Second domain of FERM 6.41e-31
Family Second domain of FERM 0.0000638
Further Details:      
 
Domain Number 3 Region: 22-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.65e-27
Family First domain of FERM 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003307   Gene: ENSTGUG00000003203   Transcript: ENSTGUT00000003340
Sequence length 585
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:52833816:52952642:1 gene:ENSTGUG00000003203 transcript:ENSTGUT00000003340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGRAAGMIRFRSSSIRSLSAEMKCTVRLLDDSEISCHIQRETKGQFLIDHICNYYSLLEK
DYFGIRYVDPEKQRHWLEPNKSIFKQMKSHPPYTMCFRVKFYPHEPLKIKEELTRYLLYL
QIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYISDFKIFPKQSQKLDKKI
AEMHKNEFRGQSPAVAEFNLLLKANSLETYGVDPHPCKDSFGTTTFLGFTAAGFVVFQGN
KRIHLLKWCDVYKLKFEGKTFYVFGAQKEKKAVLSFHTSTPAACKHLWKCGVENQAFYKY
AKSSQIKTMSSSKIFFKGSRFRYSGKVAKEVVEASSKIQREPPEVHRTSITQSRSSPSLN
KQLIINMEPLQPLLPSPCEEEEVPLDEGIELPKEEEISVPVTSSSPVKDTGKDVDLAIEQ
EEKMKEEPLTISELVYNPSASLLPTPVDDEIDMLFDTCPRSENEKDDTDSFEELEADENA
FLIAEEEELKEARRALSWSYDFLMGNIEVNAFVKSFSRLFLVGLGLLLFVFPLFLVLLES
DLQISFLHEIRQTPEFQQFHIEYYCPLRQWMACKINFIRDILGNF
Download sequence
Identical sequences H0YYC9
ENSTGUP00000003307 ENSTGUP00000003307 59729.ENSTGUP00000003307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]