SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003312 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003312
Domain Number 1 Region: 3998-4367
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.72e-99
Family Regulator of chromosome condensation RCC1 0.0029
Further Details:      
 
Domain Number 2 Region: 368-734
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.67e-94
Family Regulator of chromosome condensation RCC1 0.00069
Further Details:      
 
Domain Number 3 Region: 4495-4843
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.62e-89
Family Hect, E3 ligase catalytic domain 0.0000602
Further Details:      
 
Domain Number 4 Region: 3423-3713,3747-3816
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.37e-35
Family WD40-repeat 0.02
Further Details:      
 
Domain Number 5 Region: 2025-2209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-34
Family SPRY domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003312
Domain Number - Region: 2745-2806
Classification Level Classification E-value
Superfamily UBA-like 0.0153
Family UBA domain 0.011
Further Details:      
 
Domain Number - Region: 1745-1890,1921-1992
Classification Level Classification E-value
Superfamily ARM repeat 0.0201
Family HspBP1 domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003312   Gene: ENSTGUG00000003191   Transcript: ENSTGUT00000003345
Sequence length 4867
Comment pep:known_by_projection chromosome:taeGut3.2.4:10:143749:216065:-1 gene:ENSTGUG00000003191 transcript:ENSTGUT00000003345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMVPPVKLKWLEHLNSSWITEDSESIATREGVSVLYAKLVSNKEVVPLPQQVLCLKGP
QLPDFERESLSSDEQDHYLDALLSSQLALAKMVCSDSPFAGALRKRLLVLQRVFYALSNK
YHDKGKVKQQQHSPESSSGSTDVHSVSERPRSSTDALIEMGVRTGLSLLFALLRQSWMMP
VAGPGLSLCNDVIYTAIEVVSSLPPLSLANESKIPPMGLDCLSQVTTFLKGVTIPNSGAD
TLGRRLASELLLGLAAQRGALRYLLEWIEMALGASAVVNTMEKTKLLQSPEGMISFDCFM
SILTQMRRSLGSSADRSQWREPTRTSDGLCSLYEAALCLFEEVCRMASDYSRTCASPDSI
QTGDAPIVSETCEVYVWGSNSSHQLVEGTQEKILQPKLASSFSDAQTIEAGQYCTFVIST
DGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRSIKKVSSSKGSDGHTLAFTTEGEVF
SWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVTEDGELYTWGEGDF
GRLGHGDSNSRNIPTLVKDIINVGEVSCGSSHTIALSKDGRTVWSFGGGDNGKLGHGDTN
RVYKPKVIEALQGMFIRKVCAGSQSSLALTSTGQVYAWGCGACLGCGSSEATALRPKLIE
ELAATRIVDISIGDSHCLALSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVGGLDGIAI
QQISAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLEHYCDKINSEIPPLP
FPSSREHHNFLKLCLKLLSNHLALALAGGVATSILGRQAGPLRNLLFRLMDSSVPDEIQE
VVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQRMQLDIILTSLQDHTHVA
SLLGYSSPSDTTETASMCISYGNLSDQAYAVQSSHPDTHLAEILMKTLLRNLGFYTDQAF
GELEKNSDKFLLGTSSSENSQPAHLHELLCSLQKQLLAYCHINSVTENSSSVALLHKHLQ
LLLPHATDIYSRSATLLKESSWNGSVGEKLRADVIYVSAAGSMLCQIVNSLLLLPVSVAR
PLLSYLLDLLPPLDRLNRLLPAAALLEDQELQWPLHGGPELIDPAGVPLPQPAQSWVWLV
DLERTVALLIGRCLGGMLQGPPVSPEEQDTAYWLKTPLFSDGVEMDIPHLDKCMSSLLEV
ALSGNEEQKPFDYKLRPEITVYVDLALGCTKEPARSLWVSMQDYAVSKDWDTATLSNESL
LDTVSRFVLAALLKHTSLLSQACGESRYQPGKALAEVYRCVYKVRSRLLACRNMQLIQTR
SSSRDRWMLDNQESADVDSQEHSFTRTIDEEAEMEEQAERDREEGHPEQEDEEEEREHEA
MTAGKIFQCFLSAREVARSRDRDRMSAGMGTRVDDPPAQSQQERRISTDLTEGQDVYTAA
CNSVIHRCALLILGVSPAIEELQKRREDGQLLQPPSAAPEGIGLMTRSESLTAESRSIHA
NSSYRLMKSRSESDLSQPESDEEGYSLSGRRNVDVDLAASHRKRGAIHSQMEFLSDSWVR
LKHSRDWLYTSSSSSFVESDFDLSRSLGIHTLIENAVSFVSGDVGNSPGFKEPEESMSTS
PQASIIAMEQQQLRAELRLEALHQILVLLSGMEEKGCVPLMGSRQVPGFQSSLLLTSVRL
QFLAGCFGLGTVGHAGAKGESVRLHHYQDGIRAAKRSIQIEIQVAVHKIYQQLSATLERA
LQANKHHIEAQQRLLLVTVFALSVHYQPVDVSLAISTGLLNVLSQLCGTDTMLGQPLQLL
PKTGISQLSTALKVASTRLLQILAITTGTYADKLSPKVVQSLLDLLCSQLKNLLSQAGVM
LMASFGEGEGEEGEVESKKADSNGDNEKRDFRAALRKQHAAELHLGDFLVFLRRVVSSKA
IQSKMASPKWTEVLLNIASQKCCSGIPLVGNLRTRLLALHVLEAVLPACESGVEDDQMAQ
VVEQLFSLLSDCMWESPIAQAKHAIQIKEKEREIKLQKQGESEDEDENLPIQEVSFDPEK
AQCCIVENGQILTHGSGGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVHD
FNHRTTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKL
AFEDVDAAELYPCVMFYSSNPGEKVKICDMQMRGTPRDLLPGDPICSPVAAVLAEATIQL
IRILHRTDRWTYCINKKMMERLNKIKTYLKEVGQKLKKSRSVQSREENEVREEKENKEEE
KSKHSRHGLAELSELQLKMLCVEVWPVLAVIGGVDAGLRVGGRCVHKQTGRHATLLGVLK
EGSTSAKVQWDEAEITISFPTFWSPSDTPLYNLEPCEPLPFDVARFRGLTATVLLDLTYL
TGIHEDTGKQSTKRHEKKHRHESEDKGEMDQKMEGDIGSDTRLGQSADDNKGHGATTSKS
ENEIASFSLEPSTLGMDSQHQPAEGRKKNHEHTPRSHDIVQSEIRAVQLSYLYLGAMKSL
SVLLSCSKYAELLLIPKVLAENGHNSDCAGSPVVHEDVELRAALQFLMRHMVKRAVMRSP
IKRALGLADLERAQAMIYKLVVHGLLEDQFGGRLKQEVEQQVEEGDQSQQAQTPVTTSPS
ASSTTSFMSSSLEDTTTATTPVTDTETVPASESPGVMPLSLLRQMFSSYPTTTVLPARRA
QTPPISSLPTSPSDEVGRRQSLTSPDSQSARPANRTALSDPSSRLSTSPPPPAIAVPLLE
MGFSLRQIAKAMEATGARGEADAQNITVLAMWMIEHPGNEDDEEPQSEGTAESQHGAIVS
GTGGKSGDHCYLQSSGDIPSADAPEMEEGFSESPDNLDHVDNAAAASGPPSRSRSAVTRR
HKFDLAARTLLARAAGLYRSVQAHRNQSRREGISLQQDPGALYDFNLDEELEIDLDDEAM
EAMFGQDLASDNDILGMWIPEVLDWPTWHVCESEDREEVVVCELCESSVVSFNQHMKRNH
PGCGRSANRQGYRSNGSYVDGWFGGECGSGNPYYLLCGICREKYLALKSKSKISALERYK
GQAPDLIGKQDSVYEEDWDMLDVDEDEKLTGEEEFELLAGPLGLNDRRIVPEPVQFPDSD
PLGASVAMVTATNSMEETLMQIGCHSSIEKSSSGRITLGEQAAALINPHDRVMALRRVTA
AAQVLLARTMVMRALSLLSVSGSSCSLAAGLESLGLTDIRTLVRLMCLAAAGRAGLSTSP
SIVSSCTERSRGIHSKTSKPISCLAYLSTAVGCLASNTPSAAKLLVQLCTQNLISAATGV
NLTTVDDPIQRKFLPSFLRGIAEENKLVTSPNFVVTQALVALLADKGAKLRPNYDKAEIE
KKGPLELANALAACCLSSRLSSQHRQWAAQQLVCTLAAHDRDNQSAPQTLADMGGDLRKC
SFIKLEAHQNRVMTCVWCNKKGLLATSGNDGTIRVWNVTKKQYSLQQTCVLNKLEGDSEE
GLGSPSDLSLSLICWSISGKYLAGATEKMVNIWQVNGGKGLLDLQSHWVSALAWPEEGPP
AAWTGDAPELLLIGRMDGSLALIEVVDISAMHRLELEHCYRKDVSVTCLAWFSEDRPFAV
GYSDGKLLLGTKEPTEKGGVVLIDAHKDTVVSMKWDPTGKILLTCAKEETVKLWGCLGGC
WRCLHSLSHPALVNGIAWCALPGKGPKAQLLLATGCHNGLVCVWTVPQDIIITLQSSSAC
SEAWWEQEASAKDGYRKAVEVKCVFQLRGHITPVRTVAFSPDGLALVSGGLGGLMNIWSL
RDGSVLQSVVIGSGAIQTAVWIPEVGVAACSNRSKDVLVVNCTSEWISSNHVLATCRTAL
KQQGVLGLNMAPCMRAFLERLPMMLQEQYAYEKPHVVCGDQLVHSPYMQCLASLAVGLHL
DQLLCNPPVPPHHQSCIPDPSAWNPTEWAWLECFSTTIKAAEALAKGAQFPESFTVPDLE
PVPEDELTLLMDNSKWINGMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRN
VMIPAAAPSFSPAQQVVCGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISAL
QGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEV
VQMSCGFKHSAVVTADGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLN
HTVAVSTDGSMVWAFGDGDYGKLGLGNSTAKSSPQKVDILCGIGIKKVACGTQFSVALTK
DGHVYTFGQVADRLIGLPEGRARNHNRPQQVPLLAGVFIEDIAVGAEHTLALSSTGDVYA
WGSNSEGQLGLGHTNHVREPTLVTVLQGKNVRQISAGRCHSAAWTAPPVPPRAPGVSVPL
QLGLPDVIPPQYGALKEVSIQTVRARLRLLYHFSDLMYSSWRLLNLSPNNQNSTSHYNAG
TWGIVQGQLRPLLAPRVYTLPMVRSIGKTMVQGKNYGPQITVKRISTRGRKCKPIFVQIA
RQVVKLIASDLRLPSRAWKVKLVGEGADDAGGVFDDTITEMCQELETGIVDLLIPSPNAT
AEVGYNRDRFLFNPSACLDEHLMQFKFLGILMGVAIRTKKPLDLHLAPMVWKQLCCIPLI
LEDLEEVDLLYVQTLNSILHIEDSGITEENFHEMIPLDSFVGQSADGKMVPIIPGGNSIP
LTFSNRKEYVERAIEYRLHEMDRQVAAVREGMSWIVPVPLLSLLTAKQLEQMVCGMPEIS
VEVLKKVVRYREVDEQHQLVQWFWHTLEEFSNEERVLFMRFVSGRSRLPANTADISQRFQ
IMKVDRPYDSLPTSQTCFFQLRLPPYSSQVIMAERLRYAINNCRSIDMDNYMLSRNVDNA
EGSDTDY
Download sequence
Identical sequences H0YYD4
59729.ENSTGUP00000003312 ENSTGUP00000003312 ENSTGUP00000003312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]