SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003324 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003324
Domain Number 1 Region: 596-895
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.59e-68
Family Tandem AAA-ATPase domain 0.0000606
Further Details:      
 
Domain Number 2 Region: 324-594
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-58
Family Tandem AAA-ATPase domain 0.0000451
Further Details:      
 
Domain Number 3 Region: 277-340
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000053
Family Chromo domain 0.0057
Further Details:      
 
Domain Number 4 Region: 199-271
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000195
Family Chromo domain 0.016
Further Details:      
 
Domain Number 5 Region: 2275-2326
Classification Level Classification E-value
Superfamily BRK domain-like 0.0000000131
Family BRK domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003324   Gene: ENSTGUG00000003179   Transcript: ENSTGUT00000003357
Sequence length 2591
Comment pep:known_by_projection chromosome:taeGut3.2.4:20:601821:697084:1 gene:ENSTGUG00000003179 transcript:ENSTGUT00000003357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGMQDSGGTGVKKKRKKKDLGEQEGGDKAAVEVKPKRRREPKEPKEPKKVKESKKPKEPK
QREVAKKPRKPREPKAPKESKDKKSGSEPAPRSRSKKSSKDTPVEKKKKGKRKNEIPVNS
LDLDQDLPSPSVQSPEESAESADSQKRRSGRQVKRRKYNEDLDFKVVDDDGETIAVLGAG
RTSALSASTLAWQAEEPPEDDANIIEKILASRMVQKEAHPGGLAFETEEFYVKYRNFSYL
HCKWATLEELEKDPRISQKIKRFRNKQAQMKHIFTEPDEDLFNPDYVEVDRILEVAHTKD
PDTGEEVTHYLVKWCSLPYEESTWELEEDVDPGKIKEFEALQIPPEIKHMERPASESWQK
LEKSREYKNSNQLREYQLEGMNWLLFNWYNRKNCILADEMGLGKTIQSITFLSEIFLMGI
HGPFLIIAPLSTITNWEREFRTWTEMNAIVYHGSQISRQMIQQYEMVYRDTQGNPLPGIF
KFQVVITTFEMILADCPELKKIQWRCVVIDEAHRLKNRNCKLLEGLKLMALEHKVLLTGT
PLQNSVEELFSLLNFLEPQQFPSETAFLEEFGDLKTEEQVKKLQSILKPMMLRRLKDDVE
KNLAPKQETIIEVELTNIQKKYYRAILEKNFSFLSKGANQHNMPNLINTMMELRKCCNHP
YLINGAEEKILEDFRKTHCPEAPDFQLQAMIQAAGKLVLIDKLLPKLIAGGHKVLIFSQM
VRCLDILEDYLIQRRYTYERIDGRVRGNLRQAAIDRFCKPDSDRFVFLLCTRAGGLGINL
TAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLD
KAVLQDINRKGSTNGVQQLSKMEVEDLLRKGAYGALMDEEDEGSKFCEEDIDQILQRRTQ
TITIQSEGKGSTFAKASFVASGNRTDISLDDPNFWQKWAKIAELDTDAKNEKESLVIDRP
RVRKQTKHYNSFEEDELMEFSELDSDSDERPTRSRRLNEKTRRYLRAECFRVEKNLLIFG
WGRWKDILTHGRFKWHLNEKDMEMICRALLVYCVKHYKGDDKIKSFIWDLITPTKDGQNQ
ALQNHSGLSAPVPRGRKGKKTKNQMLLPEIKNADWLATCNPEVVLHDDSYKKHLKQHCNK
VLLRVRMLYYLKAEVLGEAADKAFEGTPARELDVLLPDIDYVEIPVDWWNAEADKSLLIG
VFKHGYERYNAMRADPALCFLEKVGMPDEKLLSAEQGISDGAQDATERGIMEKEENSGEK
LEGLDGHMAPTDDCDRSCSPWKAEAQDGSDSDRSCWPVSSALTARLRRLVTVYQRCNRKE
LPPRTEMLVPGNHGYWLQDEMFRRASEMDLMNKEMQKRWTRREQADFYRTVSSFGIIYDQ
EKKIFDWAQFRAISRLEKKTDESLEKYFYSFVAMCKNVCGLPLWKEDGPPDPDIYVEPIT
EERAARTLYRIELLRKVREQVLKCPQLHERLKLCQPSLYLPVWWECGKHDRDLLIGTAKH
GLNRTDYYIMNDPQLSFLDAYRNYAQHKRTGLPGPETLCCLYQSNSKLYSSPVYSQMDQS
CETLENEAESHIKLEPVDSTMSQAGGSPLDTHCETFMSEVRDIISSNYDESSLPDSLVCM
MYDEKTCPSEQSSLTRDSPSCTDVGSSVAKLSEGKLEGDEDPSSCDADAMREVPFLEGLQ
VVSDQMDNQNEEAEPSPSTPDSNPSQSAPSKLSKGLEQKGALASPATGLPEHGTMERVLS
VGLYSPSLHNYELKQRFISLLQEKGLKAKSGPSQSHSEEDEEEEEDDDNSEAAADAEEGL
NGSRTRADFDPEAHELGGEEQSSGLPTPEDTCPEDLNGERESLGLGEPGAEVREDCGLNE
ESTQQHSPGQAQSQPFSLPAPLPQGGPLGAEAPCAEGQTGCTETLHPEPQGIKQEECENR
DDGEKASSNQSQDGPEKYLEEENKNSASVLPGEIDDLQDARAPTIAQLLQEKTLYSFSEW
PKDRVIINRIDNICHAILKGKWPSSSQQFEAQSLLTAPAMASNTGSRSSFTESEAPDPTF
NNGVLMSRVQKEGFLSPTFAKDERKHRRPYEFEMERDAKQRSLEQLAAAHVHPPIVLNGW
REAAVDLSRGSDGSPGNSSPFPLNTNVPKLGTVNALQSSLGMDLSGILQAGLIHPVTGQI
VNGSLRRDDAAMRRRRGRRKNVEGMDLIFLKERPLPNRLQDVQEDQPQPPQNSPLPDGPV
AATSTPQPVPAAGSQEKAVPNKSLLDWLRQQSDYTLDVPSFGTNFSDKPKQRRQRCKDPN
KLDISSLTGEERVPVVHKGTGRRGYLPENKFNRILSEPVLRDTGPRRRGRRPRNELLKGP
GVVADSSSGMGPLFMNGLIAGMDLVGLQNMRNMQGIPLTGLVGFPAGFAAVPSGEDVKST
LSMLPMMLPGMATVPQMFGVGGLLNSPMTTTCTATAPTSLTSTTKGGTASTEKANEEKQG
SQDGKREPLTEDKPGPSSFSNQTESAITTSSPVAFNPFLIPGMSPGLIYPSMFLSPGIGM
ALPGIQQTRHSEAANLETQKRKRKKAKGELANPEPETVSLPEKEAANSQNCAQQSLSVVA
EKEQDGPAEEE
Download sequence
Identical sequences H0YYE6
59729.ENSTGUP00000003324 ENSTGUP00000003324 ENSTGUP00000003324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]