SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003367 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003367
Domain Number 1 Region: 428-559
Classification Level Classification E-value
Superfamily TIMP-like 1.11e-35
Family Netrin-like domain (NTR/C345C module) 0.046
Further Details:      
 
Domain Number 2 Region: 244-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family Laminin-type module 0.093
Further Details:      
 
Domain Number 3 Region: 362-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 4 Region: 311-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000162
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 5 Region: 23-131
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000085
Family CBM4/9 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003367   Gene: ENSTGUG00000003265   Transcript: ENSTGUT00000003401
Sequence length 562
Comment pep:novel chromosome:taeGut3.2.4:14:621015:642640:-1 gene:ENSTGUG00000003265 transcript:ENSTGUT00000003401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVAQQTPPDPCYDESGAPRRCIPEFVNAAFGKEVQASSTCGKPPTRHCNASDPRRAHPPA
YLTDLNTASNMTCWRSETLHHSPQNVTLTLSLGKKFEVVYVSLQFCSPRPESTAILKSMD
YGKTWVPYQYYSSQCRKIYGKPSKATVTKQNEQEALCTDGLTDLYPLTGGLIAFSTLDGR
PSAQDFDSSPVLQDWVTATDIRVVFSRPHLFRDLGSWDAAEEEGATGSTPYYYAVGELQV
GGRCKCNGHAARCVKDKEQKLVCDCKHNTEGPECDRCKPFHYDRPWQRASAREANECLAC
AVLCPSQSQHSLSLQWGTHGQAAGVCLNCRHNTAGRHCHYCKEGFYRDLSKAITDRKACK
ACDCHPVGAAGKTCNQTTGQCPCKDGVTGLTCNRCAKGYQQSRSPVAPCITLPPSPVIAC
STHCSSAADCDSYCKPAKGNYKINMKKYCKKDYVVQVNILEMETVANWAKFTINILSVYK
CRDERVKRGDNFLWIHLKDLSCKCPKIQISKKYLVMGISENSTDRPGLMADKNSLVIQWR
DAWTRRLRKLQRREKKGKCVKP
Download sequence
Identical sequences H0YYI9
59729.ENSTGUP00000003367 ENSTGUP00000003367 ENSTGUP00000003367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]