SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003385 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003385
Domain Number 1 Region: 44-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.23e-29
Family Clostridium neurotoxins, the second last domain 0.024
Further Details:      
 
Domain Number 2 Region: 313-437,501-569
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000000278
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 1373-1435
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000278
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 4 Region: 1303-1378
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000129
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 5 Region: 1249-1308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000125
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 6 Region: 1171-1245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000172
Family Complement control module/SCR domain 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003385
Domain Number - Region: 628-652,835-894
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00109
Family Fibronectin type III 0.0087
Further Details:      
 
Domain Number - Region: 1514-1543
Classification Level Classification E-value
Superfamily Notch domain 0.0366
Family Notch domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003385   Gene: ENSTGUG00000003260   Transcript: ENSTGUT00000003419
Sequence length 1587
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:3229351:3405322:1 gene:ENSTGUG00000003260 transcript:ENSTGUT00000003419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCPGHLCNRLARGRRSTAGLEPGHVPRRRQQREVKDEEESLTPSRALYFSGQGDQLRLKA
DVELPRDAFTLQVWLKAEGGQRSPAVIAGLYDKCSYTSRDRGWVLGINTVSDQGNRDPRY
FFSLKTDRARKVTTIAAHRSYLPNQWVHLAATYDGRLMRLYVNGAQVATSGEQVGSIFSL
LTLKCKVLMLGGNALNQNYRGYMEHFSLWRTARSQKEILLDMEQAIQRQDTPLPQLVLQD
SLLNVKSAWSPMKDGSSPQTKFSYHHGYLLDTSLDPPLCGQTVCDNTDVIASYNKLPRFR
RNKTVRYRVVNLYDDKHQNPTVSKQQIEFQHQHLNEAFSRYNITWELEVLDVKNSSLRHR
LILANCDISKIGDENCDPECNHTLTGYDGGDCRHVRHTLFNKKKQNGVCDMDCNYERYNF
DGGECCNPEITEVTKTCFDPYSPYRAYLDVNELKNILKLDGSTHLNIFFANSSEEELAGV
ATWPWDKEALMHLGGIVLNPSFYGIPGHTHTMIHEIGHSLGLYHVFRGISEILSCSDPCM
ETEPSFETGDLCSDTNPAPKHKLCGDPGPGNDTCGFHGFLNTPFSNFMSYADDDCTDSFT
PNQVARMHCYLDLVYQSWQPTKKPAPVAIAPQIVARTSTSVTLEWFPPIDGHFFEREVGS
ACDLCAEGRVLVQYAFSASSPMPCDPSGHWSPREAEGHPDVEQPCKSSVRTWSPNSAVNQ
HTVPPACPEPQGCYLQLEFRYPLTPESLTVWVTFVSPDWDSSGAVNDIKLLTVSGKNISL
GPQNVFCDIPLTIKLDVGQVGEEVYGIQIYTLDEHLEIDAAMLSSVPHSTLCSGCKPIQY
KVVRDPPFQSGSAVVISNLSRRFVDTELSDRTTYRYQVVIVSGMEESEPSPALLYVSGSG
YCGDGIIQIELGEECDDMNKINGDGCSLFCLQELSFNCIDEPSRCYFHDGDGVCEEFEQM
TSIKDCGVYTPKGFLDQWASNVSVSHHSDQQCPGWVVIGQPAATQMCRTKVIDLNDGVSQ
YAWYPCTANFQYSHMTQTIFWLKAYFSQPMVAAAVLVHLVTDGTYYLDQKQETIGVQLFD
TKEQSHDLGVHVLSCRNNPLIIPVIHDLSHPFYHTQAVLISFSSQFVAISGVALRSFHNF
DPITISSCQQGQTYSPAEQSCVHYSCEATDCQRLEIENAVLNCTGGTGWDSGAQCNVSCR
TGYILQIHRDDDLVKSQTESSVTMTCMDGKWNKQVTCEPVDCGVPDQYHVYPATFNCSEG
TTFGKKCSFTCRPPALLKGNNSNLTCMEDGLWSFPEALCELMCRAPSIVPNADLQTSRCR
EDKHKVGSFCKYKCKPGYHVPGSSRKSRNTKRRAFKIQCTQDGTWLPGACVPVTCDPPPS
KFHGLYQCSNGFQFNSECRIKCEDDDSQSGRGSNVIHCRKDGTWSGSFHLCREMQGQCAL
PTQLNSHLKLQCTGGYGIGTECTTSCLDHSHEPILLRVNETVQDIQHWMNPQRVKSVVCT
AGLKWYPHPSLIHCVKGCEPFMGDNYCDSINNRAFCNYDGGDCCASTVKTKKVTPFPMSC
DLQGECACRDPNAQEHNQKDLRGFSLG
Download sequence
Identical sequences H0YYK7
ENSTGUP00000003385 ENSTGUP00000003385 59729.ENSTGUP00000003385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]