SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003411 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003411
Domain Number 1 Region: 134-320
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-31
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.01e-27
Family Frizzled cysteine-rich domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003411   Gene: ENSTGUG00000003295   Transcript: ENSTGUT00000003445
Sequence length 790
Comment pep:novel chromosome:taeGut3.2.4:7:2045287:2057000:1 gene:ENSTGUG00000003295 transcript:ENSTGUT00000003445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCQPIPTRLPFCSVLGTSHVRLPNYLQHSGEEEIRAALHEWEGLLESRCHHYLEWFLCLL
LLPGCSPSVPVTPPPCQGFCEAVRDLCWTHLAGRRLPLPCDALPEEDEGVSCVFINASAE
SLSAEISLLELIDPPTEEIHRIYGPDNNPGYVFGPNANTGQVARYHLPSPFYRDFSLLFH
IQPTTPRAGVLFAVTDASQSIIYVGVKLSELRAGQQQIIFYYTEPGSPSSYPAATFTVPT
LLNQWTRFAISVEEEEVVLYLDCEEHERVRFERSPDEMELEEGSGLFVAQAGGADPDKYQ
GVIADLKLRGDPRAAERQCEEEEDDAEVSGDFGSGMEGGQQSLSKAEGVPGLVDAVPVTS
PPMVGGSGPRSGGGSLQQAERTRAEETLRVPTGGNSSSFPIPQGERVGTCQKGEKGEKGE
RGLKGDSGTSGIVGPGKTCHPLPSSSPPQGMVEQVTGPPGTPGKDGAPGRDGEPGDPGED
GKPGEMGPPGFPGMPGEPGLKGEKGDPGMGPRGPPGPPGPPGPPGPSSKNDKLTFIDMEG
SGFGGDLESLRGPRGPPGPPGPPGVPGLPGEPGRFGMNCTDLPGPPGLPGRDGIPGPPGP
GPQGPPGRDGEVGQLGPKGEQGDVGDLGLPGLPGPKGNKGEMGPAGPPGEMGLAGLPGPI
GPRGQPGPPGPPGPPGPGYEAGFGDMEGSGLAFTPGPPGPEGPQGVPGLPGVKVGSPGQP
GLPGPKVGALGDAGMPGMDGRPGPEGFPGPQGPKGDKGSTGEKGERGQDGVGLPGPPGPP
GQVISVSSED
Download sequence
Identical sequences H0YYN3
ENSTGUP00000003411 59729.ENSTGUP00000003411 ENSTGUP00000003411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]