SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003428 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003428
Domain Number 1 Region: 761-809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000614
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 2 Region: 713-763
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000142
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 3 Region: 275-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000024
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 4 Region: 807-859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000243
Family Laminin-type module 0.0029
Further Details:      
 
Domain Number 5 Region: 211-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family Laminin-type module 0.039
Further Details:      
 
Domain Number 6 Region: 916-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 7 Region: 450-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.0076
Further Details:      
 
Domain Number 8 Region: 868-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family Laminin-type module 0.057
Further Details:      
 
Domain Number 9 Region: 1024-1066
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 10 Region: 398-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1072-1119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000053
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 12 Region: 355-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family Laminin-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003428
Domain Number - Region: 1531-1712
Classification Level Classification E-value
Superfamily Tropomyosin 0.000209
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number - Region: 968-1014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family Laminin-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003428   Gene: ENSTGUG00000003257   Transcript: ENSTGUT00000003462
Sequence length 1725
Comment pep:known chromosome:taeGut3.2.4:1A:13961424:14003431:-1 gene:ENSTGUG00000003257 transcript:ENSTGUT00000003462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPNCIVSHLQEDKKCFICDSEDPFHDTLNPDSHRIENVVTTFAPNRLKLWWQSENGLEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGQTWHVYRYFAYDCESSFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIYRVLDPAFRIEDPYSPRIQNLLKITNLRVKFVKL
HTLGDNLLDSRMEIREKYYYAIYDMVVRGNCFCYGHASECAPVEGLDEEVEGMVHGHCMC
RHNTKGLNCEQCLDFYHDLPWRPAEGRNSNACKKCNCNGHSSQCHFDMAVYMTTGNTSGG
VCDDCQHNTMGRNCEQCKPFYFQHPERDLRDPDVCEPCNCDPAGSQNGGICDRYTDFSTG
LIAGQCRCKLFVEGERCDLCKEGFYGLSADDPVGCQSCACNPLGTHPGGNPCDSETGNCY
CKRLVTGKQCNQLLPEHWGLSNDMDGCRPCDCDQGGALSNNCSSESGQCECRPHMFGRQC
NQVEPGYYFISLDHYIYEAEEANLGPGVNIIERQYTPDRTPSWTGIGFVRVPEGAYLEFH
VDNIPYSMEYDVLIRYEPQLPDQWEKAVISVSRPGKIPTGSRCGNTVPDDDNQVVSLSPG
SRYVVLPRPVCFEKGLNYTIRLELSQYSLVDTETENPYTLIDSLVLMPYCKSLDIFTVGG
SGEDVVTNSAWETFQRYRCLENSRSVVKTPMTDVCKNIIFSISALLHETALSCQCDPQGS
LSSVCDPNGGQCQCRPNVVGRQCNRCAPGTFGFGPSGCRPCECHVRGSYNAFCDVETGQC
HCFPGVYGRQCDRCLPSFWGFPSCQPCHCNGHADDCNPYTGECLSCRDHTAGHNCERCQA
GYYGDPILGSGDHCRLCPCPDGPESGRQFASGCYQDPVTLQVVCVCSVGYIGSRCDECAS
GFFGSPDEVGGACQPCQCNNNIDTTDPEACDKRTGACMKCLYHTEGENCHLCREGYYGSA
LQQDCRKCVCNYLGTVREDCEGSESCRCEAATGQCRCLPNVVGQTCDRCAPTWRLASGTG
CEQCDCDPARSLGPACNEFTGQCHCMPGFGGRTCRECQELFWGDPGVECLACDCNPHGIQ
TPQCDRATGQCICNEGVEGLHCDKCSRGYSGFFPDCVPCHQCFALWDVIIGELANRTQQF
LDRANTLKITGVTGPYQQTLNTLEEKLTEIKTIIAQNPAAEPLKNIGNLFEAEKLTADVT
VKIADIEENLSALSAKSNSTDTDLSALETDAKSLDHVVKELAEQLEFIKISDVRGALDSI
TKYFQMSLEAEERVNASTVDPDSAVELSAQTRQEVEDLINEKEAQFKAKQEEQSRLLDEL
AGKLQSLDLSEVAEKTCGTAPGASCAESECGGLSCRTDEGKKKCGGPSCDGLVTVAHNAW
QKAMDFDRDILSALAEVEQLSRMVSEAKQRADEAKQNAQVVLLKTNATKEQVDRSNEDLR
NLIKQIRDFLMQDSADLDSIEAVANEVLNMEMPSTPQQLQALTEDIRERVESLSDVEVIL
QQSAGDIARAEMLLEEAKRASKGATDVKVTADMVKAALEEAEKAQNAAEKAIKQADEDIK
GTQDLLTSIESENAASAETLNNATLRLFELEKSVEDLRQKATTNVGNVGNIEDKIISAKQ
NAEEVQKVLTNELSGKYRTVEELIAKKTEESAEARRKAGVLQDEAKALLAQANSKLQLLK
DLENTYENNQKVLEDKAKQLVELEETVRSLLQTISQKVAVYSTCL
Download sequence
Identical sequences H0YYP9
ENSTGUP00000003428 ENSTGUP00000003428 59729.ENSTGUP00000003428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]