SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003491 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003491
Domain Number 1 Region: 1-238
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.08e-71
Family Eukaryotic proteases 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003491   Gene: ENSTGUG00000003391   Transcript: ENSTGUT00000003527
Sequence length 238
Comment pep:known_by_projection chromosome:taeGut3.2.4:LGE22:120622:126439:1 gene:ENSTGUG00000003391 transcript:ENSTGUT00000003527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVGGHATPEGASPRVVSMQALRGGVRFAHLCGGVVMGRRAVLTAGHCVDGRTDPCSWRAV
LGVHNLQKHSPQTARRRIRRIMVHSEFKRETFENDVAVFELRSAVRYSLSIQPACLPPAA
LLPPLENSSDCSISGWGRTSEKGKLSSVLKQAHVRILPPSLCNSSEGYAGLMNDKALCAG
AWAGGTDSCQGDSGGPLVCYHPGSDKYYLVGIASFGVGCGRPRYPGIYVRLSQYRTWI
Download sequence
Identical sequences H0YYV9
59729.ENSTGUP00000003491 ENSTGUP00000003491 ENSTGUP00000003491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]