SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003497 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003497
Domain Number 1 Region: 399-476
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000224
Family Growth factor receptor domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003497   Gene: ENSTGUG00000003383   Transcript: ENSTGUT00000003533
Sequence length 766
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:649867:833451:1 gene:ENSTGUG00000003383 transcript:ENSTGUT00000003533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWRCSAGAELFSLMALWEWIALSLHCWVLAVAAVSDQHATSPFDWLLSDKGPFHRSQEY
TDFVDRSRQGFSTRYKIYREFGRWKVNNLAVERRNFLGSPLPLAPEFFRNIRLLGRRPTL
QQITENLIKKYGTHFLLSATLGGEESLTIFVDKRKLSKRSEGSDPSANSSVVTLETLHQL
AASYFIDRDSTLRRLHHIQIASTAIKVTETRTGPLGCSNYDNLDSVSSVLVQSPENKIQL
QGLQVILPEYLQEHFVQAALSYIACNSEGEFICKDNDCWCQCGPKFPECNCPYMDIQAME
ENLLRISETWNAYNSEFEESDEFKLFMKRLPMNYFLNTSAVMHLWTMDSNFQRRYEQLES
SMKQLFLKAQRTVHKLFSLSKRCHKQPLIRMPRQRSSNYWLNRIQSFLYCNENGLLGSFS
EETHTCTCPNDQVACHSFLPCTLGDGPACLSCAPDNRTRCGSCNAGYMLSQGLCKPEVAD
STEHYIGFETDLQDLEMKYLLQKTDRRIEVHAIFISNDMRLNSWFDPSWRKRMLLTLKSN
KYKSSLVHMILGLSLQICLTKNSTLEPVLAVYINPFGGSHSESWFMPVNENNFPDWERTK
LDLPLQCYNWTLTLGNKWKTFFETVHIYLRSRIKSNGPNGNESIYYEPLEFIDPSRNLGY
MKINNIQVFGYSMHFDPEAIRDLILQLDYPYTQGSQDSALLQLLEIRDRVNKLSPPGQRR
LDLFSCLLRHRLKLSTSEVVRIQSALQAFNAKLPNTVDYDTTKLCS
Download sequence
Identical sequences H0YYW5
59729.ENSTGUP00000003497 XP_002189956.1.42559 XP_012430605.1.42559 ENSTGUP00000003497 ENSTGUP00000003497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]