SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003630 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003630
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily RING/U-box 1.94e-31
Family RING finger domain, C3HC4 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003630   Gene: ENSTGUG00000003528   Transcript: ENSTGUT00000003669
Sequence length 84
Comment pep:known_by_projection chromosome:taeGut3.2.4:18:1754168:1754493:1 gene:ENSTGUG00000003528 transcript:ENSTGUT00000003669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVRVRSWHGVASWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLNSQQVQQHCPMCRQEWKFRE
Download sequence
Identical sequences A0A218ULA9 H0YZ96 U3KBN8
ENSTGUP00000003630 ENSTGUP00000003630 ENSFALP00000012442 59729.ENSTGUP00000003630 XP_002196894.1.42559 XP_005056301.1.66865 XP_005530697.1.90289 XP_014743000.1.99236 XP_015501136.1.82291 XP_017693133.1.3805 XP_021389882.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]