SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003669 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003669
Domain Number 1 Region: 86-283
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-52
Family SPRY domain 0.00097
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003669
Domain Number - Region: 273-309
Classification Level Classification E-value
Superfamily SOCS box-like 0.0023
Family SOCS box-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003669   Gene: ENSTGUG00000003571   Transcript: ENSTGUT00000003709
Sequence length 353
Comment pep:known_by_projection chromosome:taeGut3.2.4:14:1650785:1656382:-1 gene:ENSTGUG00000003571 transcript:ENSTGUT00000003709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSMARRPRSSRAWRFVLSGVRREADGWAGARGWGYDSDGQHSDSDSEPEFSSLSPSIPSA
IPVTGESYCNCENQSEAPYCSSLHALHRVRDCRCGEEDEYFDWVWDDLNKSTATLLTCDN
RKVNFHMEYSCGTAAIRGNKELAEGQHFWEIKMTSPVYGTDMMVGIGTSDVNLDKYRHTF
CSLLGKDEDSWGLSYTGLLHHKGDKTNFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGV
AATKLQNKKFYPMVCSTAAKSSMKVIRSCASRTSLQYLCCFRLRQLLPDYVDTLEVLPLP
PGLKQVLHNKLGWVLSMNYSTSKPSSSSSSGSDSDSSCGSDAEACQRKRCRRT
Download sequence
Identical sequences H0YZD5
ENSTGUP00000003669 ENSTGUP00000003669 59729.ENSTGUP00000003669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]