SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003676 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003676
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.84e-40
Family GABARAP-like 0.00000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003676   Gene: ENSTGUG00000003576   Transcript: ENSTGUT00000003716
Sequence length 109
Comment pep:known_by_projection chromosome:taeGut3.2.4:20:1588734:1596224:1 gene:ENSTGUG00000003576 transcript:ENSTGUT00000003716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPADRCKEVQQIREQHPNKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRL
QLNPTQAFFLLVNQHSMVSVSTPISEIYEQEKDEDGFLYMVYASQETFG
Download sequence
Identical sequences A0A091EYI1 A0A091MUS7 A0A091T618 H0YZE2
ENSTGUP00000003676 59729.ENSTGUP00000003676 ENSTGUP00000003676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]