SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003699 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003699
Domain Number 1 Region: 393-500
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.07e-38
Family Transforming growth factor (TGF)-beta 0.0000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003699   Gene: ENSTGUG00000003594   Transcript: ENSTGUT00000003739
Sequence length 500
Comment pep:known_by_projection chromosome:taeGut3.2.4:20:1640652:1643697:1 gene:ENSTGUG00000003594 transcript:ENSTGUT00000003739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKILHFLTLLLWHLTWLSLDLVPGALSNSEAGQGNPGSKLGFLKAEGKERNPSARAGTLR
TSSHGYSAGTSKARTKSSAAQAGALLAKNDDSKKVPSRTAAAEGKVGHLPSRPSGVRTVT
PKVQNLSSKVALKKTGTSSTDTDSFKTKKTKEPVTQREAKETFRHPPITPHEYMLSLYRT
LSDAERKGVNGSVKLEAGLANTITSFIDKGQDERAPTIRKQKYIFDISALEKDGLLGAEL
RILRKKPSDTWKSHSSGKTSQVKLFSCSTNRQASTLLDSRTVSITNTPKWEVFDIWKLFR
NFKNLVNLCFELETFDRGRAVDLRSVGFNRTGRQVNEKALFLVFGRTKKRDLFFNEIKAR
SGQDDKTVYEYLFNQRRKRRAPLATRQGKRPTKNLKARCSRKALHVNFKDMGWDDWIIAP
LEYEAYHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDS
ANNVVYKQYEDMVVESCGCR
Download sequence
Identical sequences H0YZG5
ENSTGUP00000003699 ENSTGUP00000003699 XP_002186862.1.42559 59729.ENSTGUP00000003699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]