SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003709 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003709
Domain Number 1 Region: 714-929
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-106
Family Thrombospondin C-terminal domain 0.000000104
Further Details:      
 
Domain Number 2 Region: 587-712
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.89e-34
Family TSP type-3 repeat 0.00000502
Further Details:      
 
Domain Number 3 Region: 210-255
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 3.66e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00078
Further Details:      
 
Domain Number 4 Region: 517-589
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.14e-16
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 5 Region: 449-530
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000157
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 6 Region: 40-148
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000105
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 7 Region: 302-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000858
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 355-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000523
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003709
Domain Number - Region: 272-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00684
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 408-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0774
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003709   Gene: ENSTGUG00000003565   Transcript: ENSTGUT00000003749
Sequence length 947
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:55507223:55610018:-1 gene:ENSTGUG00000003565 transcript:ENSTGUT00000003749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AALLMLPRQLELSSSEPCPLVVPVFDLLPYSNKRVVLNFLQQAFGDPMLNEVYLLSTFKL
QPKSTATVFGLYSSADNSKYFEFTVMGRMSKAVLRYLKSDGRLNSVIFSNIQLADGKPHA
VILWLSGLQQGLSTVELYLDCLQVGAIEDLPKPFSALSQKVVSAELRTLQEKPQDTLDEL
KLVTGGTLAEVGNLQDCFLQQIEAVPQYTGDFNRQLMGQMMQMNQLLGDVKDLLRQQVKE
TTFLRNTIAECQACGLGTVSFPTQLPRRTKPKCEVNSCFRGVRCMETAEGFQCGPCPEGL
TGNGVTCSDIDECRYNPCFPGVRCVNTAPGFRCETCPPGYTGQAVQGIGLSYAKNNKQVC
LDIDECQNGGLGLCVPNSHCINTLGSYQCGHCKPGYTGDQTRGCQAERSCRNQALNPCSI
HARCIEEKRGEVTCTCGIGWAGDGYICGKDVDIDGYPNEELSCSAENCRKDNCRFVPNSG
QEDADGDGIGDACDDDADGDGIPNEQDNCVLVPNVNQRNSDQDIFGDACDNCRNVLNNDQ
RDTDGDGKGDACDDDMDGDGIKNLLDNCQRIPNEDQEDTDNDGVGDACDSCPTISNPNQS
DVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSSQLDTDKDGLGDECDDDDDNDGIPD
LLPPGPDNCRLVPNLGQEDDNGDGVGDVCESDFDQDTVIDRIDVCPENAEITLTDFRAYQ
TVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDD
YAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLW
HTGDTNDQVRLLWKDPRNVGWKDKVSYRWFLQHRPQIGYIRARFYEGSDLVADSGVTIDT
TMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQAQQFGVGDI
Download sequence
Identical sequences H0YZH5
ENSTGUP00000003709 59729.ENSTGUP00000003709 ENSTGUP00000003709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]