SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003714 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003714
Domain Number 1 Region: 10-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.83e-24
Family UBX domain 0.00011
Further Details:      
 
Domain Number 2 Region: 355-452
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.61e-20
Family UBX domain 0.035
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003714
Domain Number - Region: 79-125
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00502
Family UBX domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003714   Gene: ENSTGUG00000003598   Transcript: ENSTGUT00000003754
Sequence length 488
Comment pep:known_by_projection chromosome:taeGut3.2.4:18:1807773:1842148:1 gene:ENSTGUG00000003598 transcript:ENSTGUT00000003754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGGGGAAVSVLAPSGRRVTVRVGPGTVLLQVLEEVCRKQGGSPGEYGLNFQRNVLDL
SLQWRFARLPNNAKLEMVPISRRAGPGTTVRIALQLDDGSRLQDTFLCQQTLWELLNHFA
KIRELMEQDGELSPVCIYMRDEVSGKDALEKTTLKSLGLIGGNAVIRVVMKKCSSSAGEE
VVDATVPCNEPTVRRGSMEEAVDVPLPQANTFPKDLEHRDVAVSLNSCTHKQDSIKDSHA
SLEELWHSPEPEPTQFVPFFGDGEHLGDSSVAVPSSKLPTTFSSPGGPSKPKKSKNSQEL
RKEQEQLVEREPLICHLDLLEQLPDGQEELPDEFFEVTVDDVRKRLAQLQNERKCLEEAP
LMTKSLKESQLKEKLERYPKVVVRVRFPDRHVLQGFFHPTETVGILKEFVRSYLADAELP
FYLFVAPPRIILNDESLTLFEAKLFPTAVIHFGSEECRACFLKSDLLSSAVSPSEADLLV
ARCLSRSL
Download sequence
Identical sequences H0YZI0
ENSTGUP00000003714 59729.ENSTGUP00000003714 ENSTGUP00000003714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]